missing translation for 'onlineSavingsMsg'
Learn More
Learn More
Beschreibung
FAXC Polyclonal specifically detects FAXC in Human, Mouse, Rat samples. It is validated for Western Blot, Immunohistochemistry, Immunocytochemistry/Immunofluorescence, Immunohistochemistry-Paraffin.
Spezifikation
Spezifikation
| Antigen | C6orf168 |
| Anwendungen | Western Blot, Immunohistochemistry, Immunocytochemistry, Immunofluorescence, Immunohistochemistry (Paraffin) |
| Klassifikation | Polyclonal |
| Konjugat | Unconjugated |
| Verdünnung | Western Blot 0.4 ug/ml, Immunohistochemistry 1:200 - 1:500, Immunocytochemistry/Immunofluorescence 1 - 4 ug/ml, Immunohistochemistry-Paraffin 1:200 - 1:500 |
| Zusammensetzung | PBS (pH 7.2) and 40% Glycerol with 0.02% Sodium Azide |
| Gen-Alias | C6orf168, chromosome 6 open reading frame 168, dJ273F20, failed axon connections homolog (Drosophila) |
| Gensymbole | FAXC |
| Wirtsspezies | Rabbit |
| Immunogen | This antibody was developed against Recombinant Protein corresponding to amino acids:HFYWTLAYCQWVDNLNETRKMLSLSGGGPFSNLLRWVVCHITKGIVKREMHGHGIGRFSEEEIYMLMEKDMRSLAGLLG |
| Mehr anzeigen |
For Research Use Only
Name des Produkts
Indem Sie auf Absenden klicken, erklären Sie sich damit einverstanden, dass Fisher Scientific sich mit Ihnen in Verbindung setzen kann, um Ihr Feedback in diesem Formular zu bearbeiten. Wir werden Ihre Informationen nicht für andere Zwecke weitergeben. Alle bereitgestellten Kontaktinformationen werden in Übereinstimmung mit unserer Datenschutzrichtlinie aufbewahrt. Datenschutzrichtlinie.
Haben Sie Verbesserungsvorschläge?