missing translation for 'onlineSavingsMsg'
Learn More
  1. Home
  2. Products
  3. Antikörper
  4. Primärantikörper
  5. Alle Primärantikörper
  6. Fc gamma RIIA/CD32a Antibody, Novus Biologicals™

Fc gamma RIIA/CD32a Antibody, Novus Biologicals™

Artikelnummer. 18456140 Alle ansehen Bio Techne Produkte
Change view
Click to view available options
Menge:
25 μL
0.1 mL
Packungsgröße:
0.10 Milliliter
25 Mikroliter
2 product options available for selection
Product selection table with 2 available options. Use arrow keys to navigate and Enter or Space to select.
Artikelnummer. Menge unitSize
18456140 25 μL 25 Mikroliter
18497030 0.1 mL 0.10 Milliliter
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 2 options available.
2 options
Dieser Artikel kann nicht zurückgegeben werden. Rückgaberichtlinie anzeigen
Artikelnummer. 18456140 Lieferant Novus Biologicals Lieferanten-Nr. NBP18458925ul

Please to purchase this item. Need a web account? Register with us today!

Dieser Artikel kann nicht zurückgegeben werden. Rückgaberichtlinie anzeigen

Beschreibung

Rabbit Polyclonal Antibody

Fc gamma RIIA/CD32a Polyclonal antibody specifically detects Fc gamma RIIA/CD32a in Human samples. It is validated for Western Blot, Immunohistochemistry, Immunohistochemistry (Paraffin)
TRUSTED_SUSTAINABILITY

Spezifikation

Antigen Fc gamma RIIA/CD32a
Anwendungen Western Blot, Immunohistochemistry, Immunohistochemistry (Paraffin)
Klassifikation Polyclonal
Konjugat Unconjugated
Verdünnung Western Blot 0.04-0.4 ug/mL, Immunohistochemistry 1:200 - 1:500, Immunohistochemistry-Paraffin 1:200 - 1:500
Zusammensetzung PBS (pH 7.2) and 40% Glycerol
Gen-Alias CD32 antigen, CD32A, CD32MGC23887, CDw32fc-gamma-RIIa, Fc fragment of IgG, low affinity IIa, receptor (CD32), Fc fragment of IgG, low affinity IIa, receptor for (CD32), FCG2, Fc-gamma RII-a, Fc-gamma-RIIa, FcGR, FCGR2, FCGR2A1, FcRII-a, IGFR2MGC30032, IgG Fc receptor II-a, Immunoglobulin G Fc receptor II, low affinity immunoglobulin gamma Fc region receptor II-a
Wirtsspezies Rabbit
Immunogen This antibody was developed against Recombinant Protein corresponding to amino acids: RISANSTDPVKAAQFEPPGRQMIAIRKRQLEETNNDYETADGGYMTLNPRAPTDDDKNIYLTLPPNDHVNSNN
Reinigungsverfahren Immunogen affinity purified
Menge 25 μL
Regulatorischer Status RUO
Forschungsgebiet Immunology
Primär oder sekundär Primary
Gen-ID (Entrez) 2212
Zielspezies Human
Inhalt und Lagerung Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Form Purified
Isotype IgG
Mehr anzeigen Weniger anzeigen
Name des Produkts
Wählen Sie ein Thema

Indem Sie auf Absenden klicken, erklären Sie sich damit einverstanden, dass Fisher Scientific sich mit Ihnen in Verbindung setzen kann, um Ihr Feedback in diesem Formular zu bearbeiten. Wir werden Ihre Informationen nicht für andere Zwecke weitergeben. Alle bereitgestellten Kontaktinformationen werden in Übereinstimmung mit unserer Datenschutzrichtlinie aufbewahrt. Datenschutzrichtlinie.