FCRN/FCGRT Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody

Marke: Novus Biologicals NBP1-59061

Artikelnummer. 18741394

532.00 € / 100 Mikroliter

Dieser Artikel kann nicht zurückgegeben werden. Rückgaberichtlinie anzeigen

Beschreibung

FCRN/FCGRT Polyclonal specifically detects FCRN/FCGRT in Human samples. It is validated for Western Blot, Immunohistochemistry, Immunohistochemistry-Paraffin.

Spezifikation

Klassifikation	Polyclonal
Immunogen	Synthetic peptides corresponding to FCGRT(Fc fragment of IgG, receptor, transporter, alpha) The peptide sequence was selected from the N terminal of FCGRT (NP_004098). Peptide sequence GWLGPQQYLSYNSLRGEAEPCGAWVWENQVSWYWEKETTDLRIKEKLFLE.
Regulatorischer Status	RUO
Inhalt und Lagerung	Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles.

Produktvorschläge

Berichtigung von Produktinhalten

Bitte geben Sie uns Ihr Feedback zu den Produktinhalten, indem Sie das folgende Formular ausfüllen.

Product Title

Your Name

Email Address *

Type of Issue *

Detailed Description of Issue/Request *

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.

Cancel Submit

Thank You! Your feedback has been submitted. Fisher Scientific is always working to improve our content for you. We appreciate your feedback.

For Research Use Only

Spot an opportunity for improvement?Share a Content Correction

FCRN/FCGRT Antibody, Novus Biologicals™

Beschreibung

Spezifikation

Produktvorschläge

Dokumentation

Aktionen