missing translation for 'onlineSavingsMsg'
Learn More
  1. Home
  2. Products
  3. Antikörper
  4. Primärantikörper
  5. Alle Primärantikörper
  6. FFAR4/GPR120 Antibody, Novus Biologicals™

FFAR4/GPR120 Antibody, Novus Biologicals™

Artikelnummer. p-200047046 Alle ansehen Bio Techne Produkte
Change view
Click to view available options
Menge:
0.1 mL
25 μL
Packungsgröße:
0.10 Milliliter
25 Mikroliter
Artikelnummer. Menge unitSize
18424821 25 μL 25 Mikroliter
18252478 0.1 mL 0.10 Milliliter
2 options
Dieser Artikel kann nicht zurückgegeben werden. Rückgaberichtlinie anzeigen

Artikelnummer. 18424821

Marke: Novus Biologicals NBP18973925ul

Bitte Sie sich an, um diesen Artikel zu kaufen. Sie benötigen ein Web-Konto? Registrieren Sie sich noch heute!

Dieser Artikel kann nicht zurückgegeben werden. Rückgaberichtlinie anzeigen

Beschreibung

Rabbit Polyclonal Antibody

FFAR4/GPR120 Polyclonal specifically detects FFAR4/GPR120 in Human samples. It is validated for Immunohistochemistry, Immunohistochemistry-Paraffin.
TRUSTED_SUSTAINABILITY

Spezifikation

Antigen FFAR4/GPR120
Anwendungen Immunohistochemistry, Immunohistochemistry (Paraffin)
Klassifikation Polyclonal
Konjugat Unconjugated
Verdünnung Immunohistochemistry, Immunohistochemistry-Paraffin 1:10 - 1:20
Zusammensetzung PBS (pH 7.2) and 40% Glycerol with 0.02% Sodium Azide
Gen-Zugriffsnummer Q5NUL3
Gen-Alias G protein-coupled receptor 120, G protein-coupled receptor 129, G protein-coupled receptor PGR4, GPR120, GPR129, G-protein coupled receptor 120, G-protein coupled receptor 129, G-protein coupled receptor GT01, G-protein coupled receptor PGR4, G-protein-coupled receptor GT01, GT01, MGC119984, omega-3 fatty acid receptor 1, PGR4DKFZp686F0824
Gensymbole FFAR4
Wirtsspezies Rabbit
Immunogen This antibody was developed against Recombinant Protein corresponding to amino acids:FRVVPQRLPGADQEISICTLIWPTIPGEISWDV
Reinigungsverfahren Affinity Purified
Menge 25 μL
Regulatorischer Status RUO
Forschungsgebiet GPCR
Primär oder sekundär Primary
Gen-ID (Entrez) 338557
Testspezifität Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Zielspezies Human
Inhalt und Lagerung Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Isotype IgG
Mehr anzeigen Weniger anzeigen

For Research Use Only

Name des Produkts
Wählen Sie ein Thema

Indem Sie auf Absenden klicken, erklären Sie sich damit einverstanden, dass Fisher Scientific sich mit Ihnen in Verbindung setzen kann, um Ihr Feedback in diesem Formular zu bearbeiten. Wir werden Ihre Informationen nicht für andere Zwecke weitergeben. Alle bereitgestellten Kontaktinformationen werden in Übereinstimmung mit unserer Datenschutzrichtlinie aufbewahrt. Datenschutzrichtlinie.