missing translation for 'onlineSavingsMsg'
Learn More
  1. Home
  2. Products
  3. Antikörper
  4. Primärantikörper
  5. Alle Primärantikörper
  6. Fibrillin 2 Antibody, Novus Biologicals™

Fibrillin 2 Antibody, Novus Biologicals™

Artikelnummer. 18443321 Alle ansehen Bio Techne Produkte
Change view
Click to view available options
Menge:
25 μL
Packungsgröße:
0.10 Milliliter
25 Mikroliter
2 product options available for selection
Product selection table with 2 available options. Use arrow keys to navigate and Enter or Space to select.
Artikelnummer. Menge unitSize
18443321 25 μL 25 Mikroliter
18750034 - 0.10 Milliliter
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 2 options available.
2 options
Dieser Artikel kann nicht zurückgegeben werden. Rückgaberichtlinie anzeigen
Artikelnummer. 18443321 Lieferant Novus Biologicals Lieferanten-Nr. NBP18816925ul

Bitte Sie sich an, um diesen Artikel zu kaufen. Sie benötigen ein Web-Konto? Registrieren Sie sich noch heute!

Dieser Artikel kann nicht zurückgegeben werden. Rückgaberichtlinie anzeigen

Beschreibung

Rabbit Polyclonal Antibody has been used in 2 publications

Fibrillin 2 Polyclonal specifically detects Fibrillin 2 in Human samples. It is validated for Western Blot, Immunohistochemistry, Immunohistochemistry-Paraffin, Immunohistochemistry-Frozen.
TRUSTED_SUSTAINABILITY

Spezifikation

Antigen Fibrillin 2
Anwendungen Western Blot, Immunohistochemistry, Immunohistochemistry (Paraffin), Immunohistochemistry (Frozen), In Situ Hybridization (ISH)
Klassifikation Polyclonal
Konjugat Unconjugated
Verdünnung Western Blot 0.04-0.4 ug/ml, Immunohistochemistry 1:50 - 1:200, Immunohistochemistry-Paraffin 1:50 - 1:200, Immunohistochemistry-Frozen Reported in scientific literature (PMID 26679090).
Zusammensetzung PBS (pH 7.2) and 40% Glycerol with 0.02% Sodium Azide
Gen-Alias CCA, congenital contractural arachnodactyly, DA9, fibrillin 2, fibrillin 5, fibrillin-2
Gensymbole FBN2
Wirtsspezies Rabbit
Immunogen This antibody was developed against Recombinant Protein corresponding to amino acids:GMCFSGLVNGRCAQELPGRMTKMQCCCEPGRCWGIGTIPEACPVRGSEEYRRLCMDGLPMGGIPGSAGSRPGGTGGNGFAPSGNGNGYGPGGTGFIPIPGGNGFSPGVGGAGVGAGGQGPIITGLTILNQ
Reinigungsverfahren Affinity Purified
Menge 25 μL
Regulatorischer Status RUO
Forschungsgebiet Cytoskeleton Markers
Primär oder sekundär Primary
Gen-ID (Entrez) 2201
Testspezifität Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Zielspezies Human
Inhalt und Lagerung Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Isotype IgG
Mehr anzeigen Weniger anzeigen

For Research Use Only

Name des Produkts
Wählen Sie ein Thema

Indem Sie auf Absenden klicken, erklären Sie sich damit einverstanden, dass Fisher Scientific sich mit Ihnen in Verbindung setzen kann, um Ihr Feedback in diesem Formular zu bearbeiten. Wir werden Ihre Informationen nicht für andere Zwecke weitergeben. Alle bereitgestellten Kontaktinformationen werden in Übereinstimmung mit unserer Datenschutzrichtlinie aufbewahrt. Datenschutzrichtlinie.