missing translation for 'onlineSavingsMsg'
Learn More
Learn More
Glutamate Dehydrogenase 2/GLUD2 Antibody, Novus Biologicals™
Rabbit Polyclonal Antibody
Marke: Novus Biologicals NBP1-55437
Dieser Artikel kann nicht zurückgegeben werden.
Rückgaberichtlinie anzeigen
Beschreibung
Glutamate Dehydrogenase 2/GLUD2 Polyclonal specifically detects Glutamate Dehydrogenase 2/GLUD2 in Human samples. It is validated for Western Blot.
Spezifikation
| Glutamate Dehydrogenase 2/GLUD2 | |
| Polyclonal | |
| Unconjugated | |
| PBS, 2% Sucrose with 0.09% Sodium Azide | |
| EC 1.4.1, EC 1.4.1.3, GDH 2, GDH2, GLUDP1, glutamate dehydrogenase 2, glutamate dehydrogenase 2, mitochondrial, glutamate dehydrogenase pseudogene 1 | |
| Rabbit | |
| 61 kDa | |
| 100 μL | |
| Primary | |
| Centrifuge the vial of lyoph antibody at 12,000 x g for 20 seconds. Add 50μL of distilled water. Vortex followed by centrifuge again to pellet the solution.Final concentration is 1mg/mL in PBS buffer. | |
| Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles. |
| Western Blot | |
| 0.5 mg/ml | |
| Western Blot 1.0 ug/ml | |
| P49448 | |
| GLUD2 | |
| Synthetic peptides corresponding to GLUD2(glutamate dehydrogenase 2) The peptide sequence was selected from the N terminal of GLUD2. Peptide sequence MYRYLAKALLPSRAGPAALGSAANHSAALLGRGRGQPAAASQPGLALAAR. | |
| Affinity purified | |
| RUO | |
| 2747 | |
| Human | |
| IgG |
Berichtigung von Produktinhalten
Bitte geben Sie uns Ihr Feedback zu den Produktinhalten, indem Sie das folgende Formular ausfüllen.
Name des Produkts
For Research Use Only
Haben Sie Verbesserungsvorschläge?Übermitteln Sie eine inhaltliche Korrektur