missing translation for 'onlineSavingsMsg'
Learn More
Learn More
Glutathione Peroxidase 1/GPX1 Antibody, Novus Biologicals™
Rabbit Monoclonal Antibody
213.00 € - 507.00 €
Spezifikation
| Antigen | Glutathione Peroxidase 1/GPX1 |
|---|---|
| Verdünnung | Western Blot 1:1000 - 1:5000, ELISA Recommended starting concentration is 1 μg/mL |
| Anwendungen | ELISA, Western Blot |
| Klassifikation | Monoclonal |
| Konjugat | Unconjugated |
| Produktcode | Marke | Menge | Preis | Menge & Verfügbarkeit | |||||
|---|---|---|---|---|---|---|---|---|---|
| Produktcode | Marke | Menge | Preis | Menge & Verfügbarkeit | |||||
|
30231532
|
Novus Biologicals
NBP3-33354-20ul |
20 μL |
213.00 €
20 Mikroliter |
Log in om dit product te kopen Registreer vandaag om een webaccount aan te maken | |||||
|
30228402
|
Novus Biologicals
NBP3-33354-100ul |
100 μL |
507.00 €
100 Mikroliter |
Log in om dit product te kopen Registreer vandaag om een webaccount aan te maken | |||||
Beschreibung
Glutathione Peroxidase 1/GPX1 Monoclonal antibody specifically detects Glutathione Peroxidase 1/GPX1 in Human,Mouse,Rat samples. It is validated for ELISA,Western BlotSpezifikation
| Glutathione Peroxidase 1/GPX1 | |
| ELISA, Western Blot | |
| Unconjugated | |
| Rabbit | |
| Apoptosis, Cancer, Cell Biology, Endocrinology, Neurodegeneration, Neuroscience, Signal Transduction | |
| PBS (pH 7.3), 50% glycerol, 0.05% BSA | |
| 2876 | |
| IgG | |
| Affinity purified |
| Western Blot 1:1000 - 1:5000, ELISA Recommended starting concentration is 1 μg/mL | |
| Monoclonal | |
| Purified | |
| RUO | |
| Human, Mouse, Rat | |
| Cellular glutathione peroxidase, EC 1.11.1, EC 1.11.1.9, glutathione peroxidase 1, GPx-1, GSHPx-1, GSHPX1, MGC14399, MGC88245 | |
| A synthetic peptide corresponding to a sequence within amino acids 100-203 of human Glutathione Peroxidase 1/GPX1 (NP_000572.2).,, Sequence:, RPGGGFEPNFMLFEKCEVNGAGAHPLFAFLREALPAPSDDATALMTDPKLITWSPVCRNDVAWNFEKFLVGPDGVPLRRYSRRFQTIDIEPDIEALLSQGPSCA | |
| Primary | |
| Store at -20°C. Avoid freeze-thaw cycles. |
Haben Sie Verbesserungsvorschläge?Übermitteln Sie eine inhaltliche Korrektur
Berichtigung von Produktinhalten
Bitte geben Sie uns Ihr Feedback zu den Produktinhalten, indem Sie das folgende Formular ausfüllen.
Name des Produkts