missing translation for 'onlineSavingsMsg'
Learn More
Learn More
GPER/GPR30 Antibody, Novus Biologicals™
Rabbit Polyclonal Antibody
379.05 € - 600.00 €
Spezifikation
| Antigen | GPER/GPR30 |
|---|---|
| Verdünnung | Immunocytochemistry/ Immunofluorescence 0.25-2 ug/mL |
| Anwendungen | Immunocytochemistry |
| Klassifikation | Polyclonal |
| Konjugat | Unconjugated |
| Produktcode | Marke | Menge | Preis | Menge & Verfügbarkeit | |||||
|---|---|---|---|---|---|---|---|---|---|
| Produktcode | Marke | Menge | Preis | Menge & Verfügbarkeit | |||||
|
18679654
|
Novus Biologicals
NBP3-21238-25ul |
25 μL |
401.00 € 379.05 € / 25 Mikroliter Sparen 21.95 € 5% Rabatt |
Bitte melden Sie sich an, um diesen Artikel zu kaufen. Sie benötigen ein Web-Konto? Registrieren Sie sich noch heute! | |||||
|
18621964
|
Novus Biologicals
NBP3-21238-100ul |
100 μL |
600.00 €
100 Mikroliter |
Bitte melden Sie sich an, um diesen Artikel zu kaufen. Sie benötigen ein Web-Konto? Registrieren Sie sich noch heute! | |||||
Beschreibung
GPER/GPR30 Polyclonal antibody specifically detects GPER/GPR30 in Human samples. It is validated for Immunocytochemistry/ ImmunofluorescenceSpezifikation
| GPER/GPR30 | |
| Immunocytochemistry | |
| Unconjugated | |
| Rabbit | |
| Breast Cancer, Cancer, GPCR, Neuroscience | |
| PBS, pH 7.2, 40% glycerol | |
| 2852 | |
| IgG | |
| Affinity purified |
| Immunocytochemistry/ Immunofluorescence 0.25-2 ug/mL | |
| Polyclonal | |
| Purified | |
| RUO | |
| Human | |
| CEPRG-protein coupled receptor 30, Chemoattractant receptor-like 2, chemokine receptor-like 2, CMKRL2MGC99678, constitutively expressed peptide-like receptor, DRY12IL8-related receptor DRY12, FEG-1mER, Flow-induced endothelial G-protein coupled receptor 1, G protein-coupled estrogen receptor 1, G protein-coupled receptor 30, GPCR-BR, GPR30GPCR-Br, G-protein coupled estrogen receptor 1, heptahelix receptor, LERGU, LERGU2, leucine rich protein in GPR30 3'UTR, LyGPR, Lymphocyte-derived G-protein coupled receptor, Membrane estrogen receptor | |
| This antibody was developed against Recombinant Protein corresponding to amino acids: MDVTSQARGVGLEMYPGTAQPAAPNTTSPELNLSHPLLGTALANGTGELSEHQQYVIGLFLS | |
| Primary | |
| Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
Haben Sie Verbesserungsvorschläge?Übermitteln Sie eine inhaltliche Korrektur
Berichtigung von Produktinhalten
Bitte geben Sie uns Ihr Feedback zu den Produktinhalten, indem Sie das folgende Formular ausfüllen.
Name des Produkts