missing translation for 'onlineSavingsMsg'
Learn More
  1. Home
  2. Products
  3. Antikörper
  4. Primärantikörper
  5. Alle Primärantikörper
  6. 18731923

HIV-1 Gag p24 Antibody, Alexa Fluor™ 750, Novus Biologicals™

Artikelnummer. 18731923 Alle ansehen Bio Techne Produkte
Change view
Click to view available options
Menge:
0.1 mL
Unit Size:
0.10 Milliliter
1 product options available for selection
Product selection table with 1 available options. Use arrow keys to navigate and Enter or Space to select.
Product Code. Menge unitSize
18731923 0.1 mL 0.10 Milliliter
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 1 options available.
1 options
This item is not returnable. View return policy
Product Code. 18731923 Supplier Novus Biologicals Supplier No. NBP241214AF750

Bitte Sie sich an, um diesen Artikel zu kaufen. Sie benötigen ein Web-Konto? Registrieren Sie sich noch heute!

This item is not returnable. View return policy

Description

Rabbit Polyclonal Antibody

HIV-1 Gag p24 Polyclonal antibody specifically detects HIV-1 Gag p24 in Virus samples. It is validated for Western Blot, ELISA
TRUSTED_SUSTAINABILITY

Specifications

Antigen HIV-1 Gag p24
Anwendungen Western Blot, ELISA
Klassifikation Polyclonal
Konjugat Alexa Fluor 750
Zusammensetzung 50mM Sodium Borate
Wirtsspezies Rabbit
Immunogen Antibody was raised against a recombinant full-length HIV-1 Gag p24 protein . Amino Acid Squence: pivqniqgqmvhqaisprtlnawvkvveekafspevipmfsalsegatpqdlntmlntvgghqaamqmlketineeaaewdrvhpvhagpiapgqmreprgsdiagttstlqeqigwmtnnppipvgeiykrwiilglnkivrmysptsildirqgpkepfrdyvdrfyktlraeqasqevknwmtetllvqnanpdcktilkalgpaatleemmtacqgvggpghkarvla
Reinigungsverfahren Peptide affinity purified
Menge 0.1 mL
Regulatorischer Status RUO
Forschungsgebiet Infections (Virus Bacteria and Parasites)
Primär oder sekundär Primary
Gen-ID (Entrez) 155030
Zielspezies Virus
Inhalt und Lagerung Store at 4°C in the dark.
Form Purified
Isotype IgG
Show More Show Less
Product Title
Select an issue

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.