missing translation for 'onlineSavingsMsg'
Learn More
  1. Home
  2. Products
  3. Antikörper
  4. Primärantikörper
  5. Alle Primärantikörper
  6. HSCB Antibody, Novus Biologicals™

HSCB Antibody, Novus Biologicals™

Artikelnummer. p-200046137 Alle ansehen Bio Techne Produkte
Change view
Click to view available options
Menge:
25 μL
Packungsgröße:
0.10 Milliliter
25 Mikroliter
Artikelnummer. Menge unitSize
18410461 25 μL 25 Mikroliter
18729833 - 0.10 Milliliter
2 options
Dieser Artikel kann nicht zurückgegeben werden. Rückgaberichtlinie anzeigen

Artikelnummer. 18410461

Marke: Novus Biologicals NBP18406625ul

Bitte Sie sich an, um diesen Artikel zu kaufen. Sie benötigen ein Web-Konto? Registrieren Sie sich noch heute!

Dieser Artikel kann nicht zurückgegeben werden. Rückgaberichtlinie anzeigen

Descrizione

Rabbit Polyclonal Antibody has been used in 1 publication

HSCB Polyclonal specifically detects HSCB in Human samples. It is validated for Western Blot, Immunohistochemistry, Immunohistochemistry-Paraffin.
TRUSTED_SUSTAINABILITY

Specifica

Antigen HSCB
Anwendungen Western Blot, Immunohistochemistry, Immunohistochemistry (Paraffin)
Klassifikation Polyclonal
Konjugat Unconjugated
Verdünnung Western Blot 0.04-0.4 ug/mL, Immunohistochemistry 1:200 - 1:500, Immunohistochemistry-Paraffin 1:200 - 1:500
Zusammensetzung PBS (pH 7.2) and 40% Glycerol with 0.02% Sodium Azide
Gen-Alias DnaJ homolog subfamily C member 20, DNAJC20DnaJ (Hsp40) homolog, subfamily C, member 20, Hsc20, HSC20dJ366L4.2, HscB iron-sulfur cluster co-chaperone homolog (E. coli), iron-sulfur cluster co-chaperone protein HscB, mitochondrial, Jac1, J-type co-chaperone HSC20, MGC2637, MGC74462
Gensymbole HSCB
Wirtsspezies Rabbit
Immunogen This antibody was developed against Recombinant Protein corresponding to amino acids:QFLIEIMEINEKLAEAESEAAMKEIESIVKAKQKEFTDNVSSAFEQDDFEEAKEILTKMRYFSNIEEKIKLKK
Reinigungsverfahren Affinity Purified
Menge 25 μL
Regulatorischer Status RUO
Forschungsgebiet metabolism
Primär oder sekundär Primary
Gen-ID (Entrez) 150274
Testspezifität Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Zielspezies Human
Inhalt und Lagerung Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Isotype IgG
Vedi altri risultati Mostra meno risultati

For Research Use Only

Titolo del prodotto
Selezionare un problema

Facendo clic su Invia, l'utente riconosce che potrebbe essere contattato da Fisher Scientific in merito al feedback fornito in questo modulo. Non condivideremo le vostre informazioni per altri scopi. Tutte le informazioni di contatto fornite saranno conservate in conformità con la nostra Politica sulla privacy. Informativa sulla privacy.