missing translation for 'onlineSavingsMsg'
Learn More

Invitrogen™ Human ADAMTS4 (aa 104-195) Control Fragment Recombinant Protein

Artikelnummer. 30203023
Change view
Click to view available options
Menge:
100 μl
Packungsgröße:
100 Mikroliter
Artikelnummer. Menge unitSize
30203023 100 μl 100 Mikroliter
1 options
Dieser Artikel kann nicht zurückgegeben werden. Rückgaberichtlinie anzeigen

Artikelnummer. 30203023

Marke: Invitrogen™ RP106333

Bitte Sie sich an, um diesen Artikel zu kaufen. Sie benötigen ein Web-Konto? Registrieren Sie sich noch heute!

Dieser Artikel kann nicht zurückgegeben werden. Rückgaberichtlinie anzeigen

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (95%), Rat (95%). This recombinant protein control fragment may be used for blocking experiments. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

This gene encodes a member of the ADAMTS protein family. Members of the family share several distinct protein modules, including a propeptide region, a metalloproteinase domain, a disintegrin-like domain, and a thrombospondin type 1 motif. Individual members of this family differ in the number of C-terminal TS motifs, and some have unique C-terminal domains. The enzyme encoded by this gene lacks a C-terminal TS motif. It is responsible for the degradation of aggrecan, a major proteoglycan of cartilage, and brevican, a brain-specific extracellular matrix protein. The cleavage of aggrecan and brevican suggests key roles of this enzyme in arthritic disease and in the central nervous system, potentially, in the progression of glioma.
TRUSTED_SUSTAINABILITY

Spezifikation

Zugriffsnummer O75173
Konzentration ≥5.0 mg/mL
Zur Verwendung mit (Anwendung) Blocking Assay, Control
Zusammensetzung 1 M urea, PBS with no preservative; pH 7.4
Gen-ID (Entrez) 9507
Name Human ADAMTS4 (aa 104-195) Control Fragment
Menge 100 μl
Kennzeichnung RUO
Gen-Alias 3830423K05; a disintegrin and metallopeptidase with thrombospondin motifs 4; a disintegrin and metalloproteinase; A disintegrin and metalloproteinase with thrombospondin motifs 4; a disintegrin-like and metallopeptidase (reprolysin type) with thrombospondin type 1 motif, 4; a disintegrin-like and metalloprotease (reprolysin type) with thrombospondin type 1 motif, 4; ADAM; ADAM metallopeptidase with thrombospondin type 1 motif 4; ADAM metallopeptidase with thrombospondin type 1 motif, 4; ADAMs; ADAM-TS 4; ADAMTS family member; ADAMTS-2; Adamts4; ADAM-TS4; ADAMTS-4; ADMP-1; Aggrecanase; Aggrecanase 1; aggrecanase-1; disintegrin and metalloproteinase with thrombospondin motifs 2; KIAA0688; metalloendopeptidases; metalloproteinase; mKIAA0688; UNQ769/PRO1563
Gebräuchliche Bezeichnung ADAMTS4
Gensymbol ADAMTS4
Konjugat Unconjugated
Spezies Human
Rekombinant Recombinant
Proteinmarkierung His-ABP-tag
Sequenz VEGLTVQYLGQAPELLGGAEPGTYLTGTINGDPESVASLHWDGGALLGVLQYRGAELHLQPLEGGTPNSAGGPGAHILRRKSPASGQGPMCN
Inhalt und Lagerung -20°C, Avoid Freeze/Thaw Cycles
Expressionssystem E. coli
Form Liquid
Reinheits- oder Qualitätsgrad >80% by SDS-PAGE and Coomassie blue staining
Mehr anzeigen Weniger anzeigen
Name des Produkts
Wählen Sie ein Thema

Indem Sie auf Absenden klicken, erklären Sie sich damit einverstanden, dass Fisher Scientific sich mit Ihnen in Verbindung setzen kann, um Ihr Feedback in diesem Formular zu bearbeiten. Wir werden Ihre Informationen nicht für andere Zwecke weitergeben. Alle bereitgestellten Kontaktinformationen werden in Übereinstimmung mit unserer Datenschutzrichtlinie aufbewahrt. Datenschutzrichtlinie.