missing translation for 'onlineSavingsMsg'
Learn More

Invitrogen™ Human alpha Synuclein (aa 46-139) Control Fragment Recombinant Protein

Artikelnummer. 30210882
Click to view available options
Menge:
100 μl
Packungsgröße:
100 Mikroliter
Dieser Artikel kann nicht zurückgegeben werden. Rückgaberichtlinie anzeigen

Artikelnummer. 30210882

Marke: Invitrogen™ RP102342

Bitte Sie sich an, um diesen Artikel zu kaufen. Sie benötigen ein Web-Konto? Registrieren Sie sich noch heute!

Dieser Artikel kann nicht zurückgegeben werden. Rückgaberichtlinie anzeigen

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (93%), Rat (93%). This recombinant protein control fragment may be used for blocking experiments. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

Alpha-synuclein is a member of the synuclein family, which also includes beta- and gamma-synuclein. These proteins are abundant in the brain and play a role in regulating synaptic transmission and membrane trafficking. Alpha- and beta-synuclein have been shown to selectively inhibit phospholipase D2, suggesting that they may also be involved in signaling pathways. Defects in the SNCA gene, which encodes alpha-synuclein, have been implicated in the pathogenesis of Parkinson's disease. Additionally, alpha-synuclein peptides are a major component of amyloid plaques in the brains of patients with Alzheimer's disease. Multiple alternatively spliced transcripts encoding different isoforms have been identified for this gene. Diseases associated with SNCA include Parkinson Disease 1, Autosomal Dominant and Dementia, Lewy Body.
TRUSTED_SUSTAINABILITY

Spezifikation

Zugriffsnummer P37840
Konzentration ≥5.0 mg/mL
Zur Verwendung mit (Anwendung) Blocking Assay, Control
Zusammensetzung 1 M urea, PBS with no preservative; pH 7.4
Gen-ID (Entrez) 6622
Name Human alpha Synuclein (aa 46-139) Control Fragment
Menge 100 μl
Kennzeichnung RUO
Gen-Alias Alpha synuclein; alphaSYN; alpha-synuclein; NACP; non A-beta component of AD amyloid; non-A beta component of AD amyloid; non-A4 component of amyloid; Non-A4 component of amyloid precursor; PARK1; PARK4; PD1; Snca; Syn; synuclein alpha; synuclein alpha-140; synuclein, alpha; synuclein, alpha (non A4 component of amyloid precursor)
Gebräuchliche Bezeichnung alpha Synuclein
Gensymbol SNCA
Konjugat Unconjugated
Spezies Human
Rekombinant Recombinant
Proteinmarkierung His-ABP-tag
Sequenz EGVVHGVATVAEKTKEQVTNVGGAVVTGVTAVAQKTVEGAGSIAAATGFVKKDQLGKNEEGAPQEGILEDMPVDPDNEAYEMPSEEGYQDYEPE
Inhalt und Lagerung -20°C, Avoid Freeze/Thaw Cycles
Expressionssystem E. coli
Form Liquid
Reinheits- oder Qualitätsgrad >80% by SDS-PAGE and Coomassie blue staining
Mehr anzeigen Weniger anzeigen
Berichtigung von Produktinhalten

Bitte geben Sie uns Ihr Feedback zu den Produktinhalten, indem Sie das folgende Formular ausfüllen.

Name des Produkts

Indem Sie auf Absenden klicken, erklären Sie sich damit einverstanden, dass Fisher Scientific sich mit Ihnen in Verbindung setzen kann, um Ihr Feedback in diesem Formular zu bearbeiten. Wir werden Ihre Informationen nicht für andere Zwecke weitergeben. Alle bereitgestellten Kontaktinformationen werden in Übereinstimmung mit unserer Datenschutzrichtlinie aufbewahrt. Datenschutzrichtlinie.

Vielen Dank, dass Sie uns helfen, unsere Website zu verbessern. Ihr Feedback wurde übermittelt