missing translation for 'onlineSavingsMsg'
Learn More
  1. Home
  2. Products
  3. Rekombinante Proteine
  4. 16202380

Abnova™ Human APOE (E2) (P02649) Partial Recombinant Protein

Artikelnummer. 16202380
Click to view available options
Menge:
100 μg
Packungsgröße:
100 Mikrogramm
Dieser Artikel kann nicht zurückgegeben werden. Rückgaberichtlinie anzeigen

Artikelnummer. 16202380

Marke: Abnova™ P5943.100ug

om dit product te kopen Registreer vandaag om een webaccount aan te maken

Dieser Artikel wurde eingestellt und ist leider nicht mehr verfügbar. Sehen Sie sich das Produkt an, um alternative Produktvorschläge zu sehen oder kontaktieren Sie unseren Technischen Support unter 056 618 41 11.
 Alternative Produkte anzeigen

Dieser Artikel kann nicht zurückgegeben werden. Rückgaberichtlinie anzeigen

Beschreibung

Used for SDS-PAGE

Chylomicron remnants and very low density lipoprotein (VLDL) remnants are rapidly removed from the circulation by receptor-mediated endocytosis in the liver. Apolipoprotein E, a main apoprotein of the chylomicron, binds to a specific receptor on liver cells and peripheral cells. ApoE is essential for the normal catabolism of triglyceride-rich lipoprotein constituents. The APOE gene is mapped to chromosome 19 in a cluster with APOC1 and APOC2. Defects in apolipoprotein E result in familial dysbetalipoproteinemia, or type III hyperlipoproteinemia (HLP III), in which increased plasma cholesterol and triglycerides are the consequence of impaired clearance of chylomicron and VLDL remnants. [provided by RefSeq]

Sequence: MKVEQAVETEPEPELRQQTEWQSGQRWELALGRFWDYLRWVQTLSEQVQEELLSSQVTQELRALMDETMKELKAYKSELEEQLTPVAEETRARLSKELQAAQARLGADMEDVCGRLVQYRGEVQAMLGQSTEELRVRLASHLRKLRKRLLRDADDLQKCLAVYQAGAREGAERGLSAIRERLGPLVEQGRVRAATVGSLAGQPLQERAQAWGERLRARMEEMGSRTRDRLDEVKEQVAEVRAKLEEQAQQIRLQAEAFQARLKSWFEPLVEDMQRQWAGLVEKVQAAVGTSAAPVPSDNH

Spezifikation

Zugriffsnummer P02649
Zur Verwendung mit (Anwendung) SDS-PAGE
Zusammensetzung Lyophilized
Gen-ID (Entrez) 348
Molekulargewicht 34.3kDa
Name APOE (E2) (Human) Recombinant Protein
Vorbereitungsmethode Escherichia coli expression system
Menge 100 μg
Immunogen MKVEQAVETEPEPELRQQTEWQSGQRWELALGRFWDYLRWVQTLSEQVQEELLSSQVTQELRALMDETMKELKAYKSELEEQLTPVAEETRARLSKELQAAQARLGADMEDVCGRLVQYRGEVQAMLGQSTEELRVRLASHLRKLRKRLLRDADDLQKCLAVYQAGAREGAERGLSAIRERLGPLVEQGRVRAATVGSLAGQPLQERAQAWGERLRARMEEMGSRTRDRLDEVKEQVAEVRAKLEEQAQQIRLQAEAFQARLKSWFEPLVEDMQRQWAGLVEKVQAAVGTSAAPVPSDNH
Lagerungsbedingungen Store at -20°C. Aliquot to avoid repeated freezing and thawing.
Kennzeichnung RUO
Endotoxin-Konzentration <0.1ng/μg of protein (<1 EU/μg).
Gen-Alias AD2/LPG/MGC1571/apoprotein
Gebräuchliche Bezeichnung APOE
Gensymbol APOE
Assays Tissue dissociation (combined with other enzymes); Cell harvesting by trypsinization; Mitochondria isolation; in vitro studies of proteins; Various hemagglutination procedures; Sample preparation for flow cytometric DNA analysis; Tryptic mapping; Fingerprinting and sequencing work; Environmental monitoring; Subculturing cells; Cleavage fusion proteins; Generating glycopeptides from purified glycoproteins.
Kreuzreaktivität Human ;Human
Spezies E. coli
Rekombinant Recombinant
Proteinmarkierung None
Expressionssystem Escherichia coli expression system
Form Lyophilized
Reinheits- oder Qualitätsgrad 0.9
Mehr anzeigen Weniger anzeigen
Berichtigung von Produktinhalten

Bitte geben Sie uns Ihr Feedback zu den Produktinhalten, indem Sie das folgende Formular ausfüllen.

Name des Produkts

Indem Sie auf Absenden klicken, erklären Sie sich damit einverstanden, dass Fisher Scientific sich mit Ihnen in Verbindung setzen kann, um Ihr Feedback in diesem Formular zu bearbeiten. Wir werden Ihre Informationen nicht für andere Zwecke weitergeben. Alle bereitgestellten Kontaktinformationen werden in Übereinstimmung mit unserer Datenschutzrichtlinie aufbewahrt. Datenschutzrichtlinie.

Vielen Dank, dass Sie uns helfen, unsere Website zu verbessern. Ihr Feedback wurde übermittelt