missing translation for 'onlineSavingsMsg'
Learn More
  1. Home
  2. Products
  3. Rekombinante Proteine
  4. 30211307

Invitrogen™ Human ASCL1 (aa 77-112) Control Fragment Recombinant Protein

Artikelnummer. 30211307
Change view
Click to view available options
Menge:
100 μl
Packungsgröße:
100 Mikroliter
Artikelnummer. Menge unitSize
30211307 100 μl 100 Mikroliter
1 options
Dieser Artikel kann nicht zurückgegeben werden. Rückgaberichtlinie anzeigen

Artikelnummer. 30211307

Marke: Invitrogen™ RP109550

Bitte Sie sich an, um diesen Artikel zu kaufen. Sie benötigen ein Web-Konto? Registrieren Sie sich noch heute!

Dieser Artikel kann nicht zurückgegeben werden. Rückgaberichtlinie anzeigen

Beschreibung

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (97%), Rat (97%). This recombinant protein control fragment may be used for blocking experiments. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

ASCL1 (also known as ASH1) is a basic helix-loop-helix transcription factor that is required for early development of the nervous system. Expressed in fetal brain, ASCL1 is essential for the proper development of autonomic neurons and for the survival of subsets of autonomic neurons. ASCL1 interaction with MEF-2A may regulate the expression of specific genes that are critical for the formation of distinct neuronal circuits within the central nervous system. The high level of ASCL1 expression in neuroendocrine tumors, such as medullary thyroid cancer, small cell lung cancer and lung cancer with neuroendocrine features may provide a useful marker for cancers with neuroendocrine features. Mapping to human chromosome 12, the ASCL1 gene contains a trinucleotide repeat region, making this locus a candidate for inherited disease.
TRUSTED_SUSTAINABILITY

Spezifikation

Zugriffsnummer P50553
Konzentration 3.7 mg/mL
Zur Verwendung mit (Anwendung) Neutralization, Control
Zusammensetzung PBS, 1M urea with no preservative; pH 7.4
Gen-ID (Entrez) 429
Name Human ASCL1 (aa 77-112) Control Fragment
pH-Bereich 7.4
Reinigungsverfahren Purified
Menge 100 μl
Lagerungsbedingungen -20°C, Avoid Freeze/Thaw Cycles
Kennzeichnung RUO
Gen-Alias achaete scute protein; achaete-scute complex homolog 1; achaete-scute complex homolog 1 (Drosophila); achaete-scute complex homolog-like 1; achaete-scute complex-like 1; achaete-scute complex-like protein 1; achaete-scute family bHLH transcription factor 1; achaete-scute homolog 1; AI225900; Ascl1; ASH1; ASH-1; bHLHa46; Class A basic helix-loop-helix protein 46; HASH1; KMT2H; mammalian achaete scute homolog 1; Mash1; mASH-1
Gebräuchliche Bezeichnung ASCL1
Gensymbol Ascl1
Produkttyp Protein
Konjugat Unconjugated
Spezies Human
Rekombinant Recombinant
Proteinmarkierung His-ABP-tag
Sequenz GGHKSAPKQVKRQRSSSPELMRCKRRLNFSGFGYSL
Inhalt und Lagerung -20°C, Avoid Freeze/Thaw Cycles
Expressionssystem E. coli
Form Liquid
Reinheits- oder Qualitätsgrad >80% by SDS-PAGE and Coomassie blue staining
Mehr anzeigen Weniger anzeigen
Name des Produkts
Wählen Sie ein Thema

Indem Sie auf Absenden klicken, erklären Sie sich damit einverstanden, dass Fisher Scientific sich mit Ihnen in Verbindung setzen kann, um Ihr Feedback in diesem Formular zu bearbeiten. Wir werden Ihre Informationen nicht für andere Zwecke weitergeben. Alle bereitgestellten Kontaktinformationen werden in Übereinstimmung mit unserer Datenschutzrichtlinie aufbewahrt. Datenschutzrichtlinie.