missing translation for 'onlineSavingsMsg'
Learn More

Invitrogen™ Human CD79a (aa 32-84) Control Fragment Recombinant Protein

Artikelnummer. 30208797
Click to view available options
Menge:
100 μl
Packungsgröße:
100 Mikroliter
Dieser Artikel kann nicht zurückgegeben werden. Rückgaberichtlinie anzeigen

Artikelnummer. 30208797

Marke: Invitrogen™ RP109786

Bitte Sie sich an, um diesen Artikel zu kaufen. Sie benötigen ein Web-Konto? Registrieren Sie sich noch heute!

Dieser Artikel kann nicht zurückgegeben werden. Rückgaberichtlinie anzeigen

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (51%), Rat (51%). This recombinant protein control fragment may be used for blocking experiments. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

CD79a is a disulphide-linked heterodimer that includes B29 (CD79b) polypeptide. CD79a is a B lymphocyte antigen receptor with an antigen-specific surface component Ig (immunoglobulin) that associates with Ig-alpha and Ig-beta, necessary elements for the expression and function of the B-cell antigen receptor. CD79a first appears at pre-B cell stage and persists until the plasma cell stage where it is found as an intracellular component. CD79a is found in the majority of acute leukemias of precursor B cell type, in B cell lines, B cell lymphomas, and in some myelomas. It is not present in myeloid or T cell lines. Diseases associated with CD79a include Agammaglobulinemia 3 and Agammaglobulinemia, Non-Bruton type.
TRUSTED_SUSTAINABILITY

Spezifikation

Zugriffsnummer P11912
Konzentration ≥5.0 mg/mL
Zur Verwendung mit (Anwendung) Blocking Assay, Control
Zusammensetzung 1 M urea, PBS with no preservative; pH 7.4
Gen-ID (Entrez) 973
Name Human CD79a (aa 32-84) Control Fragment
Menge 100 μl
Kennzeichnung RUO
Gen-Alias B-cell antigen receptor; B-cell antigen receptor complex-associated protein alpha chain; B-cell antigen receptor complex-associated protein alpha chain-like; CD79; CD79a; CD79A antigen (immunoglobulin-associated alpha); CD79a molecule; CD79a molecule, immunoglobulin-associated alpha; CD79A protein; CD79-alpha protein; EGK_10665; Ig alpha; IGA; Igalpha; ig-alpha; immunoglobulin-associated alpha; LOC100913063; Ly54; Ly-54; MB1; MB-1; MB-1 membrane glycoprotein; Membrane-bound immunoglobulin-associated protein; surface IgM-associated protein
Gebräuchliche Bezeichnung CD79a
Gensymbol CD79A
Konjugat Unconjugated
Spezies Human
Rekombinant Recombinant
Proteinmarkierung His-ABP-tag
Sequenz ALWMHKVPASLMVSLGEDAHFQCPHNSSNNANVTWWRVLHGNYTWPPEFLGPG
Inhalt und Lagerung -20°C, Avoid Freeze/Thaw Cycles
Expressionssystem E. coli
Form Liquid
Reinheits- oder Qualitätsgrad >80% by SDS-PAGE and Coomassie blue staining
Mehr anzeigen Weniger anzeigen
Berichtigung von Produktinhalten

Bitte geben Sie uns Ihr Feedback zu den Produktinhalten, indem Sie das folgende Formular ausfüllen.

Name des Produkts

Indem Sie auf Absenden klicken, erklären Sie sich damit einverstanden, dass Fisher Scientific sich mit Ihnen in Verbindung setzen kann, um Ihr Feedback in diesem Formular zu bearbeiten. Wir werden Ihre Informationen nicht für andere Zwecke weitergeben. Alle bereitgestellten Kontaktinformationen werden in Übereinstimmung mit unserer Datenschutzrichtlinie aufbewahrt. Datenschutzrichtlinie.

Vielen Dank, dass Sie uns helfen, unsere Website zu verbessern. Ihr Feedback wurde übermittelt