missing translation for 'onlineSavingsMsg'
Learn More
  1. Home
  2. Products
  3. Rekombinante Proteine
  4. 30210662

Invitrogen™ Human CHD2 (aa 1667-1745) Control Fragment Recombinant Protein

Artikelnummer. 30210662
Change view
Click to view available options
Menge:
100 μl
Packungsgröße:
100 Mikroliter
Artikelnummer. Menge unitSize
30210662 100 μl 100 Mikroliter
1 options
Dieser Artikel kann nicht zurückgegeben werden. Rückgaberichtlinie anzeigen

Artikelnummer. 30210662

Marke: Invitrogen™ RP101493

Bitte Sie sich an, um diesen Artikel zu kaufen. Sie benötigen ein Web-Konto? Registrieren Sie sich noch heute!

Dieser Artikel kann nicht zurückgegeben werden. Rückgaberichtlinie anzeigen

Beschreibung

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (96%), Rat (96%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-84466 (PA5-84466. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

The CHD family of proteins is characterized by the presence of chromo domains and SNF2-related helicase/ATPase domains. CHD genes alter gene expression possibly by modification of chromatin structure thus altering access of the transcriptional apparatus to its chromosomal DNA template. Alternatively spliced transcript variants encoding distinct isoforms have been found for this gene.
TRUSTED_SUSTAINABILITY

Spezifikation

Zugriffsnummer O14647
Konzentration ≥5.0 mg/mL
Zur Verwendung mit (Anwendung) Blocking Assay, Control
Zusammensetzung 1 M urea, PBS with no preservative; pH 7.4
Gen-ID (Entrez) 1106
Name Human CHD2 (aa 1667-1745) Control Fragment
Menge 100 μl
Kennzeichnung RUO
Gen-Alias 2810013C04Rik; 2810040A01Rik; 5630401D06Rik; AI851092; ATP-dependent helicase CHD2; BC029703; chd2; CHD-2; chromodomain helicase DNA binding protein 2; chromodomain-helicase-DNA-binding protein 2; DKFZp547I1315; DKFZp686E01200; DKFZp781D1727; Down syndrome cell adhesion molecule; EEOC; FLJ38614; LOW QUALITY PROTEIN: chromodomain-helicase-DNA-binding protein 2; si:ch211-196l7.5
Gebräuchliche Bezeichnung CHD2
Gensymbol CHD2
Konjugat Unconjugated
Spezies Human
Rekombinant Recombinant
Proteinmarkierung His-ABP-tag
Sequenz QHWYKDHHYGDRRHMDAHRSGSYRPNNMSRKRPYDQYSSDRDHRGHRDYYDRHHHDSKRRRSDEFRPQNYHQQDFRRMS
Inhalt und Lagerung -20°C, Avoid Freeze/Thaw Cycles
Expressionssystem E. coli
Form Liquid
Reinheits- oder Qualitätsgrad >80% by SDS-PAGE and Coomassie blue staining
Mehr anzeigen Weniger anzeigen
Name des Produkts
Wählen Sie ein Thema

Indem Sie auf Absenden klicken, erklären Sie sich damit einverstanden, dass Fisher Scientific sich mit Ihnen in Verbindung setzen kann, um Ihr Feedback in diesem Formular zu bearbeiten. Wir werden Ihre Informationen nicht für andere Zwecke weitergeben. Alle bereitgestellten Kontaktinformationen werden in Übereinstimmung mit unserer Datenschutzrichtlinie aufbewahrt. Datenschutzrichtlinie.