missing translation for 'onlineSavingsMsg'
Learn More
  1. Home
  2. Products
  3. Rekombinante Proteine
  4. 30213020

Invitrogen™ Human ELK1 (aa 85-167) Control Fragment Recombinant Protein

Artikelnummer. 30213020
Click to view available options
Menge:
100 μl
Packungsgröße:
100 Mikroliter
Dieser Artikel kann nicht zurückgegeben werden. Rückgaberichtlinie anzeigen

Artikelnummer. 30213020

Marke: Invitrogen™ RP107332

om dit product te kopen Registreer vandaag om een webaccount aan te maken

Dieser Artikel kann nicht zurückgegeben werden. Rückgaberichtlinie anzeigen

Beschreibung

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (86%), Rat (86%). This recombinant protein control fragment may be used for blocking experiments. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

ELK1 is a component of the ternary complex that binds the serum response element (SRE) and mediates gene activity in response to serum and growth factors. ELK1 is phosphorylated by MAP kinase pathways at a cluster of S/T motifs at its C-terminus. Phosphorylation at these sites, particularly Ser383, is critical for transcriptional activation by ELK1. ELK1 appears to be a direct target of activated MAP kinase. Biochemical studies indicate that ELK1 is a good substrate for MAP kinase, the kinetics of ELK1 phosphorylation and activation correlate with MAP kinase activity, and interfering mutants of MAP kinase block ELK1 activation in vivo. ELK1 is a nuclear target for the ras-raf-MAPK signaling cascade. Alternatively spliced transcript variants encoding the same protein have been found for ELK1.
TRUSTED_SUSTAINABILITY

Spezifikation

Zugriffsnummer P19419
Konzentration ≥5.0 mg/mL
Zur Verwendung mit (Anwendung) Blocking Assay, Control
Zusammensetzung 1 M urea, PBS with no preservative; pH 7.4
Gen-ID (Entrez) 2002
Name Human ELK1 (aa 85-167) Control Fragment
Menge 100 μl
Kennzeichnung RUO
Gen-Alias ELK 1; ELK1; Elk-1; ELK1, ETS transcription factor; ELK1, member of ETS oncogene family; ETS domain-containing protein Elk-1; ETS transcription factor ELK1; ETS-like gene 1; Oncogene Elk1; tyrosine kinase (ELK1) oncogene
Gebräuchliche Bezeichnung ELK1
Gensymbol ELK1
Konjugat Unconjugated
Spezies Human
Rekombinant Recombinant
Proteinmarkierung His-ABP-tag
Sequenz FVSYPEVAGCSTEDCPPQPEVSVTSTMPNVAPAAIHAAPGDTVSGKPGTPKGAGMAGPGGLARSSRNEYMRSGLYSTFTIQSL
Inhalt und Lagerung -20°C, Avoid Freeze/Thaw Cycles
Expressionssystem E. coli
Form Liquid
Reinheits- oder Qualitätsgrad >80% by SDS-PAGE and Coomassie blue staining
Mehr anzeigen Weniger anzeigen
Berichtigung von Produktinhalten

Bitte geben Sie uns Ihr Feedback zu den Produktinhalten, indem Sie das folgende Formular ausfüllen.

Name des Produkts

Indem Sie auf Absenden klicken, erklären Sie sich damit einverstanden, dass Fisher Scientific sich mit Ihnen in Verbindung setzen kann, um Ihr Feedback in diesem Formular zu bearbeiten. Wir werden Ihre Informationen nicht für andere Zwecke weitergeben. Alle bereitgestellten Kontaktinformationen werden in Übereinstimmung mit unserer Datenschutzrichtlinie aufbewahrt. Datenschutzrichtlinie.

Vielen Dank, dass Sie uns helfen, unsere Website zu verbessern. Ihr Feedback wurde übermittelt