missing translation for 'onlineSavingsMsg'
Learn More

Invitrogen™ Human HLA-DOA (aa 25-74) Control Fragment Recombinant Protein

Artikelnummer. 30198670
Change view
Click to view available options
Menge:
100 μl
Packungsgröße:
100 Mikroliter
1 product options available for selection
Product selection table with 1 available options. Use arrow keys to navigate and Enter or Space to select.
Artikelnummer. Menge unitSize
30198670 100 μl 100 Mikroliter
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 1 options available.
1 options
Dieser Artikel kann nicht zurückgegeben werden. Rückgaberichtlinie anzeigen
Artikelnummer. 30198670 Lieferant Invitrogen™ Lieferanten-Nr. RP109842

Bitte Sie sich an, um diesen Artikel zu kaufen. Sie benötigen ein Web-Konto? Registrieren Sie sich noch heute!

Dieser Artikel kann nicht zurückgegeben werden. Rückgaberichtlinie anzeigen

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (86%), Rat (86%). This recombinant protein control fragment may be used for blocking experiments. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

Reacts with HLA-DO, a heterodimer formed by DNalpha and DObeta subunits in B cells. DNalpha and DObeta are the products of the non-classical class II genes, HLA-DNA and HLA-DOB, respectively. DO forms tight complexes with DM in the endoplasmic reticulum and is thereby sorted to lysosomal vesicles during antigen processing and presentation. It is tightly associated with DM and it is selectively expressed on antigen-presenting cells, such as B cells, dendritic cells and thymic epithelial cells. DO can enhance the efficiency of peptide loading and has been found to stabilize DM at low pH, preserving its chaperon activity. DO-DM complexes are more efficient than DM in protecting empty DR molecules. Reports describe DO as a co-chaperone of DM. HLA and MHC antibodies play a significant role in Immunopeptidomics, facilitating the identification and characterization of neoantigens through high-performance liquid chromatography coupled to tandem Mass Spectrometry.
TRUSTED_SUSTAINABILITY

Spezifikation

Zugriffsnummer P06340
Konzentration ≥5.0 mg/mL
Zur Verwendung mit (Anwendung) Blocking Assay, Control
Zusammensetzung 1 M urea, PBS with no preservative; pH 7.4
Gen-ID (Entrez) 3111
Name Human HLA-DOA (aa 25-74) Control Fragment
Menge 100 μl
Kennzeichnung RUO
Gen-Alias HLA class II histocompatibility antigen, DO alpha chain; HLA-D0-alpha; HLA-DNA; HLA-DOA; HLADZ; HLA-DZA; lymphocyte antigen; major histocompatibility complex, class II, DN alpha; major histocompatibility complex, class II, DO alpha; MHC class II antigen DOA; MHC DN-alpha; MHC DZ alpha
Gebräuchliche Bezeichnung HLA-DOA
Gensymbol HLA-DOA
Konjugat Unconjugated
Spezies Human
Rekombinant Recombinant
Proteinmarkierung His-ABP-tag
Sequenz ATKADHMGSYGPAFYQSYGASGQFTHEFDEEQLFSVDLKKSEAVWRLPEF
Inhalt und Lagerung -20°C, Avoid Freeze/Thaw Cycles
Expressionssystem E. coli
Form Liquid
Reinheits- oder Qualitätsgrad >80% by SDS-PAGE and Coomassie blue staining
Mehr anzeigen Weniger anzeigen
Name des Produkts
Wählen Sie ein Thema

Indem Sie auf Absenden klicken, erklären Sie sich damit einverstanden, dass Fisher Scientific sich mit Ihnen in Verbindung setzen kann, um Ihr Feedback in diesem Formular zu bearbeiten. Wir werden Ihre Informationen nicht für andere Zwecke weitergeben. Alle bereitgestellten Kontaktinformationen werden in Übereinstimmung mit unserer Datenschutzrichtlinie aufbewahrt. Datenschutzrichtlinie.