missing translation for 'onlineSavingsMsg'
Learn More

Invitrogen™ Human Lysozyme (aa 82-147) Control Fragment Recombinant Protein

Artikelnummer. 30200637
Change view
Click to view available options
Menge:
100 μl
Packungsgröße:
100 Mikroliter
Artikelnummer. Menge unitSize
30200637 100 μl 100 Mikroliter
1 options
Dieser Artikel kann nicht zurückgegeben werden. Rückgaberichtlinie anzeigen

Artikelnummer. 30200637

Marke: Invitrogen™ RP100897

Bitte Sie sich an, um diesen Artikel zu kaufen. Sie benötigen ein Web-Konto? Registrieren Sie sich noch heute!

Dieser Artikel kann nicht zurückgegeben werden. Rückgaberichtlinie anzeigen

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (76%), Rat (76%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-111271 (PA5-111271. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

This gene encodes human lysozyme, whose natural substrate is the bacterial cell wall peptidoglycan (cleaving the beta[1-4]glycosidic linkages between N-acetylmuramic acid and N-acetylglucosamine). Lysozyme is one of the anti-microbial agents found in human milk, and is also present in spleen, lung, kidney, white blood cells, plasma, saliva, and tears. Missense mutations in LYZ have been identified in heritable renal amyloidosis.
TRUSTED_SUSTAINABILITY

Spezifikation

Zugriffsnummer P61626
Konzentration ≥5.0 mg/mL
Zur Verwendung mit (Anwendung) Blocking Assay, Control
Zusammensetzung 1 M urea, PBS with no preservative; pH 7.4
Gen-ID (Entrez) 4069
Name Human Lysozyme (aa 82-147) Control Fragment
Menge 100 μl
Kennzeichnung RUO
Gen-Alias 1,4-beta-N-acetylmuramidase C; 1700038F02Rik; 4-beta-N-acetylmuramidase C; AI326280; Allergen Gal d IV; bA534G20.1; c-type lysozyme; dystrophin; egg white lysozyme; Gal d 4; KAAG648; LYC2; Lys; Lysm; lysozyme; lysozyme (renal amyloidosis); lysozyme 1; lysozyme 2; lysozyme C; Lysozyme C type M; lysozyme C type P; Lysozyme C, spleen isozyme; lysozyme C-1; Lysozyme C-2; lysozyme C-3; lysozyme d1; lysozyme F1; lysozyme like 1; lysozyme-like 1; lysozyme-like protein 1; lysozyme-like protein 2; Lysz; LYZ; Lyz1; Lyz2; LYZC; LYZD1; LYZF1; LYZL1; Lyzs; Lzm; Lzm-s1; Lzp; Lzp-s; P lysozyme structural; PRO1278; renal amyloidosis; RGD1559869; unnamed protein product; UNQ648/PRO1278
Gebräuchliche Bezeichnung Lysozyme
Gensymbol LYZ
Konjugat Unconjugated
Spezies Human
Rekombinant Recombinant
Proteinmarkierung His-ABP-tag
Sequenz WCNDGKTPGAVNACHLSCSALLQDNIADAVACAKRVVRDPQGIRAWVAWRNRCQNRDVRQYVQGCG
Inhalt und Lagerung -20°C, Avoid Freeze/Thaw Cycles
Expressionssystem E. coli
Form Liquid
Reinheits- oder Qualitätsgrad >80% by SDS-PAGE and Coomassie blue staining
Mehr anzeigen Weniger anzeigen
Name des Produkts
Wählen Sie ein Thema

Indem Sie auf Absenden klicken, erklären Sie sich damit einverstanden, dass Fisher Scientific sich mit Ihnen in Verbindung setzen kann, um Ihr Feedback in diesem Formular zu bearbeiten. Wir werden Ihre Informationen nicht für andere Zwecke weitergeben. Alle bereitgestellten Kontaktinformationen werden in Übereinstimmung mit unserer Datenschutzrichtlinie aufbewahrt. Datenschutzrichtlinie.