missing translation for 'onlineSavingsMsg'
Learn More

Invitrogen™ Human MAML2 (aa 705-792) Control Fragment Recombinant Protein

Artikelnummer. 30202480
Change view
Click to view available options
Menge:
100 μl
Packungsgröße:
100 Mikroliter
Artikelnummer. Menge unitSize
30202480 100 μl 100 Mikroliter
1 options
Dieser Artikel kann nicht zurückgegeben werden. Rückgaberichtlinie anzeigen

Artikelnummer. 30202480

Marke: Invitrogen™ RP95721

Bitte Sie sich an, um diesen Artikel zu kaufen. Sie benötigen ein Web-Konto? Registrieren Sie sich noch heute!

Dieser Artikel kann nicht zurückgegeben werden. Rückgaberichtlinie anzeigen

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (89%), Rat (89%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-57200 (PA5-57200. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

Acts as a transcriptional coactivator for NOTCH proteins. Has been shown to amplify NOTCH-induced transcription of HES1. Potentiates activation by NOTCH3 and NOTCH4 more efficiently than MAML1 or MAML3.
TRUSTED_SUSTAINABILITY

Spezifikation

Zugriffsnummer Q8IZL2
Konzentration ≥5.0 mg/mL
Zur Verwendung mit (Anwendung) Blocking Assay, Control
Zusammensetzung 1 M urea, PBS with no preservative; pH 7.4
Gen-ID (Entrez) 84441
Name Human MAML2 (aa 705-792) Control Fragment
Menge 100 μl
Kennzeichnung RUO
Gen-Alias 5930431H10; BC032967; KIAA1819; MAM2; Mam-2; MAM3; MAM-3; MAML2; mastermind like 2 (Drosophila); mastermind like transcriptional coactivator 2; mastermind-like 2; mastermind-like protein 2; mastermind-like transcriptional coactivator 2; MLL-MAML2
Gebräuchliche Bezeichnung MAML2
Gensymbol MAML2
Konjugat Unconjugated
Spezies Human
Rekombinant Recombinant
Proteinmarkierung His-ABP-tag
Sequenz YQVSQQQRQDQHSVVGQNTGPSPSPNPCSNPNTGSGYMNSQQSLLNQQLMGKKQTLQRQIMEQKQQLLLQQQMLADAEKIAPQDQINR
Inhalt und Lagerung -20°C, Avoid Freeze/Thaw Cycles
Expressionssystem E. coli
Form Liquid
Reinheits- oder Qualitätsgrad >80% by SDS-PAGE and Coomassie blue staining
Mehr anzeigen Weniger anzeigen
Name des Produkts
Wählen Sie ein Thema

Indem Sie auf Absenden klicken, erklären Sie sich damit einverstanden, dass Fisher Scientific sich mit Ihnen in Verbindung setzen kann, um Ihr Feedback in diesem Formular zu bearbeiten. Wir werden Ihre Informationen nicht für andere Zwecke weitergeben. Alle bereitgestellten Kontaktinformationen werden in Übereinstimmung mit unserer Datenschutzrichtlinie aufbewahrt. Datenschutzrichtlinie.