missing translation for 'onlineSavingsMsg'
Learn More
  1. Home
  2. Products
  3. Rekombinante Proteine
  4. 30212701

Invitrogen™ Human MICB (aa 331-381) Control Fragment Recombinant Protein

Artikelnummer. 30212701
Click to view available options
Menge:
100 μl
Packungsgröße:
100 Mikroliter
Dieser Artikel kann nicht zurückgegeben werden. Rückgaberichtlinie anzeigen

Artikelnummer. 30212701

Marke: Invitrogen™ RP107349

Bitte Sie sich an, um diesen Artikel zu kaufen. Sie benötigen ein Web-Konto? Registrieren Sie sich noch heute!

Dieser Artikel kann nicht zurückgegeben werden. Rückgaberichtlinie anzeigen

Beschreibung

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (33%), Rat (33%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-66698 (PA5-66698. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

MICB encodes the highly polymorphic MHC (HLA) class I chain-related gene B. The protein product is expressed on the cell surface. It is thought that MICB functions as a stress-induced antigen that is broadly recognized by intestinal epithelial gamma delta T cells. MICB is broadly recognized by NK cells and T cells with NKG2D receptor on their surface. The complex NKG2D-MICB results in MICB expressing cytolytic T cells and NK cells against epithelial tumor cells.
TRUSTED_SUSTAINABILITY

Spezifikation

Zugriffsnummer Q29980
Konzentration ≥5.0 mg/mL
Zur Verwendung mit (Anwendung) Blocking Assay, Control
Zusammensetzung 1 M urea, PBS with no preservative; pH 7.4
Gen-ID (Entrez) 4277
Name Human MICB (aa 331-381) Control Fragment
Menge 100 μl
Kennzeichnung RUO
Gen-Alias MHC class I chain-related protein B; MHC class I mic-B antigen; MHC class I polypeptide-related sequence B; MHC class I-like located near the LRC, 2; MHC class I-like molecule PERB11.2-IMX; MHC I like leukocyte 2; MICB; MIC-B; Mill2; Mill2 gene for MHC class I-like located near the LRC, 2, exon 3, partial cds, strain:LEW0.1 Lm1; PERB11.2; sMICB; soluble MICB; stress inducible class I homolog
Gebräuchliche Bezeichnung MICB
Gensymbol MICB
Konjugat Unconjugated
Spezies Human
Rekombinant Recombinant
Proteinmarkierung His-ABP-tag
Sequenz CKKKTSAAEGPELVSLQVLDQHPVGTGDHRDAAQLGFQPLMSATGSTGSTE
Inhalt und Lagerung -20°C, Avoid Freeze/Thaw Cycles
Expressionssystem E. coli
Form Liquid
Reinheits- oder Qualitätsgrad >80% by SDS-PAGE and Coomassie blue staining
Mehr anzeigen Weniger anzeigen
Berichtigung von Produktinhalten

Bitte geben Sie uns Ihr Feedback zu den Produktinhalten, indem Sie das folgende Formular ausfüllen.

Name des Produkts

Indem Sie auf Absenden klicken, erklären Sie sich damit einverstanden, dass Fisher Scientific sich mit Ihnen in Verbindung setzen kann, um Ihr Feedback in diesem Formular zu bearbeiten. Wir werden Ihre Informationen nicht für andere Zwecke weitergeben. Alle bereitgestellten Kontaktinformationen werden in Übereinstimmung mit unserer Datenschutzrichtlinie aufbewahrt. Datenschutzrichtlinie.

Vielen Dank, dass Sie uns helfen, unsere Website zu verbessern. Ihr Feedback wurde übermittelt