missing translation for 'onlineSavingsMsg'
Learn More

Invitrogen™ Human NT5C (aa 14-78) Control Fragment Recombinant Protein

Artikelnummer. 30212997
Click to view available options
Menge:
100 μl
Packungsgröße:
100 Mikroliter
Dieser Artikel kann nicht zurückgegeben werden. Rückgaberichtlinie anzeigen

Artikelnummer. 30212997

Marke: Invitrogen™ RP93231

om dit product te kopen Registreer vandaag om een webaccount aan te maken

Dieser Artikel kann nicht zurückgegeben werden. Rückgaberichtlinie anzeigen

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (89%), Rat (89%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-54851 (PA5-54851. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

Pyrimidine 5-prime nucleotidase and type II (UMPH2).
TRUSTED_SUSTAINABILITY

Spezifikation

Zugriffsnummer Q8TCD5
Konzentration ≥5.0 mg/mL
Zur Verwendung mit (Anwendung) Blocking Assay, Control
Zusammensetzung 1 M urea, PBS with no preservative; pH 7.4
Gen-ID (Entrez) 30833
Name Human NT5C (aa 14-78) Control Fragment
Menge 100 μl
Kennzeichnung RUO
Gen-Alias 5' nucleotidase, deoxy (pyrimidine), cytosolic type C; 5'(3')-deoxyribonucleotidase, cytosolic type; 5', 3'-nucleotidase, cytosolic; 5',3'-nucleotidase, cytosolic; 5,3-nucleotidase, cytosolic; cdN; Cytosolic 5',3'-pyrimidine nucleotidase; deoxy-5'-nucleotidase 1; Dnt; DNT1; dNT-1; epididymis luminal protein 74; HEL74; Nt5c; P5N2; PN-I; PN-II; Umph2; Umph-2; uridine 5'-monophosphate phosphohydrolase 2; uridine 5-monophosphate phosphohydrolase 2; uridine 5-prime monophosphate hydrolase 2; uridine monophosphatase 2
Gebräuchliche Bezeichnung NT5C
Gensymbol NT5C
Konjugat Unconjugated
Spezies Human
Rekombinant Recombinant
Proteinmarkierung His-ABP-tag
Sequenz VLADFEAGLLRGFRRRFPEEPHVPLEQRRGFLAREQYRALRPDLADKVASVYEAPGFFLDLEPIP
Inhalt und Lagerung -20°C, Avoid Freeze/Thaw Cycles
Expressionssystem E. coli
Form Liquid
Reinheits- oder Qualitätsgrad >80% by SDS-PAGE and Coomassie blue staining
Mehr anzeigen Weniger anzeigen
Berichtigung von Produktinhalten

Bitte geben Sie uns Ihr Feedback zu den Produktinhalten, indem Sie das folgende Formular ausfüllen.

Name des Produkts

Indem Sie auf Absenden klicken, erklären Sie sich damit einverstanden, dass Fisher Scientific sich mit Ihnen in Verbindung setzen kann, um Ihr Feedback in diesem Formular zu bearbeiten. Wir werden Ihre Informationen nicht für andere Zwecke weitergeben. Alle bereitgestellten Kontaktinformationen werden in Übereinstimmung mit unserer Datenschutzrichtlinie aufbewahrt. Datenschutzrichtlinie.

Vielen Dank, dass Sie uns helfen, unsere Website zu verbessern. Ihr Feedback wurde übermittelt