missing translation for 'onlineSavingsMsg'
Learn More
  1. Home
  2. Products
  3. Rekombinante Proteine
  4. 30208415

Invitrogen™ Human PACT (aa 85-173) Control Fragment Recombinant Protein

Artikelnummer. 30208415
Click to view available options
Menge:
100 μl
Packungsgröße:
100 Mikroliter
Dieser Artikel kann nicht zurückgegeben werden. Rückgaberichtlinie anzeigen

Artikelnummer. 30208415

Marke: Invitrogen™ RP104651

Bitte Sie sich an, um diesen Artikel zu kaufen. Sie benötigen ein Web-Konto? Registrieren Sie sich noch heute!

Dieser Artikel kann nicht zurückgegeben werden. Rückgaberichtlinie anzeigen

Beschreibung

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (100%), Rat (100%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-65135 (PA5-65135. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

PRKRA appears to have a pro-apoptotic function that may be suppressed in the presence of growth factor. It activates EIF2AK2 in the absence of double-stranded RNA (dsRNA).
TRUSTED_SUSTAINABILITY

Spezifikation

Zugriffsnummer O75569
Konzentration ≥5.0 mg/mL
Zur Verwendung mit (Anwendung) Blocking Assay, Control
Zusammensetzung 1 M urea, PBS with no preservative; pH 7.4
Gen-ID (Entrez) 8575
Name Human PACT (aa 85-173) Control Fragment
Menge 100 μl
Kennzeichnung RUO
Gen-Alias AV120107; DYT16; HSD14; HSD-14; interferon-inducible double stranded RNA-dependent protein kinase activator A; interferon-inducible double-stranded RNA-dependent protein kinase activator A; lear; PACT; PKR associated protein X; PKR-associated protein X; PKR-associating protein X; PRK; PRKRA; protein activator of interferon induced protein kinase EIF2AK2; protein activator of the interferon-induced protein kinase; protein kinase, interferon inducible double stranded RNA dependent activator; protein kinase, interferon-inducible double stranded RNA dependent activator; protein kinase, interferon-inducible double stranded RNA-dependent activator; protein kinase, interferon-inducible double-stranded RNA-dependent activator; RAX
Gebräuchliche Bezeichnung PACT
Gensymbol PRKRA
Konjugat Unconjugated
Spezies Human
Rekombinant Recombinant
Proteinmarkierung His-ABP-tag
Sequenz KLAKHRAAEAAINILKANASICFAVPDPLMPDPSKQPKNQLNPIGSLQELAIHHGWRLPEYTLSQEGGPAHKREYTTICRLESFMETGK
Inhalt und Lagerung -20°C, Avoid Freeze/Thaw Cycles
Expressionssystem E. coli
Form Liquid
Reinheits- oder Qualitätsgrad >80% by SDS-PAGE and Coomassie blue staining
Mehr anzeigen Weniger anzeigen
Berichtigung von Produktinhalten

Bitte geben Sie uns Ihr Feedback zu den Produktinhalten, indem Sie das folgende Formular ausfüllen.

Name des Produkts

Indem Sie auf Absenden klicken, erklären Sie sich damit einverstanden, dass Fisher Scientific sich mit Ihnen in Verbindung setzen kann, um Ihr Feedback in diesem Formular zu bearbeiten. Wir werden Ihre Informationen nicht für andere Zwecke weitergeben. Alle bereitgestellten Kontaktinformationen werden in Übereinstimmung mit unserer Datenschutzrichtlinie aufbewahrt. Datenschutzrichtlinie.

Vielen Dank, dass Sie uns helfen, unsere Website zu verbessern. Ihr Feedback wurde übermittelt