missing translation for 'onlineSavingsMsg'
Learn More
  1. Home
  2. Products
  3. Rekombinante Proteine
  4. 30207150

Invitrogen™ Human PDE6A (aa 418-560) Control Fragment Recombinant Protein

Artikelnummer. 30207150
Click to view available options
Menge:
100 μl
Conditionnement:
100 Mikroliter
Les retours ne sont pas autorisés pour ce produit. Afficher la politique du retour.

Code produit. 30207150

Marque: Invitrogen™ RP88965

om dit product te kopen Registreer vandaag om een webaccount aan te maken

Les retours ne sont pas autorisés pour ce produit. Afficher la politique du retour.

Description

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (97%), Rat (97%). This recombinant protein control fragment may be used for blocking experiments. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

This gene encodes the cyclic-GMP (cGMP)-specific phosphodiesterase 6A alpha subunit, expressed in cells of the retinal rod outer segment. The phosphodiesterase 6 holoenzyme is a heterotrimer composed of an alpha, beta, and two gamma subunits. cGMP is an important regulator of rod cell membrane current, and its dynamic concentration is established by phosphodiesterase 6A cGMP hydrolysis and guanylate cyclase cGMP synthesis. The protein is a subunit of a key phototransduction enzyme and participates in processes of transmission and amplification of the visual signal. Mutations in this gene have been identified as one cause of autosomal recessive retinitis pigmentosa.
TRUSTED_SUSTAINABILITY

Spécification

Zugriffsnummer P16499
Konzentration ≥5.0 mg/mL
Zur Verwendung mit (Anwendung) Blocking Assay, Control
Zusammensetzung 1 M urea, PBS with no preservative; pH 7.4
Gen-ID (Entrez) 5145
Name Human PDE6A (aa 418-560) Control Fragment
Menge 100 μl
Kennzeichnung RUO
Gen-Alias cGMP phosphodiesterase alpha; cGMP phosphodiesterase alpha subunit; cGMP phosphodiesterase alpha subunit (EC 3.1.4.35); CGPR-A; cyclic GMP phosphodiesterase alpha subunit; GMP phosphodiesterase alpha subunit; GMP-PDE alpha; nmf282; PDE V-B1; PDE6A; PDEA; phosphodiesterase 6 A; phosphodiesterase 6 A, cGMP-specific, rod, alpha; phosphodiesterase, cyclic GMP (rod receptor), alpha polypeptide; rod cGMP-specific 3',5'-cyclic phosphodiesterase subunit alpha; rod photoreceptor cGMP phosphodiesterase alpha subunit; RP43; unnamed protein product
Gebräuchliche Bezeichnung PDE6A
Gensymbol PDE6A
Konjugat Unconjugated
Spezies Human
Rekombinant Recombinant
Proteinmarkierung His-ABP-tag
Sequenz TLMESLTQFLGWSVLNPDTYESMNKLENRKDIFQDIVKYHVKCDNEEIQKILKTREVYGKEPWECEEEELAEILQAELPDADKYEINKFHFSDLPLTELELVKCGIQMYYELKVVDKFHIPQEALVRFMYSLSKGYRKITYHN
Inhalt und Lagerung -20°C, Avoid Freeze/Thaw Cycles
Expressionssystem E. coli
Form Liquid
Reinheits- oder Qualitätsgrad >80% by SDS-PAGE and Coomassie blue staining
Afficher plus Afficher moins
Correction du contenu d'un produit

Veuillez fournir vos retours sur le contenu du produit en remplissant le formulaire ci-dessous.

Nom du produit

En cliquant sur Soumettre, vous reconnaissez que vous pouvez être contacté par Fisher Scientific au sujet des informations que vous avez fournies dans ce formulaire. Nous ne partagerons pas vos informations à d'autres fins. Toutes les informations de contact fournies seront également conservées conformément à notre politique de confidentialité. Politique de confidentialité.

Merci de nous aider à améliorer notre site web. Votre commentaire a été soumis