missing translation for 'onlineSavingsMsg'
Learn More

Invitrogen™ Human PDE6A (aa 418-560) Control Fragment Recombinant Protein

Artikelnummer. 30207150
Change view
Click to view available options
Menge:
100 μl
Packungsgröße:
100 Mikroliter
Artikelnummer. Menge unitSize
30207150 100 μl 100 Mikroliter
1 options
Dieser Artikel kann nicht zurückgegeben werden. Rückgaberichtlinie anzeigen

Artikelnummer. 30207150

Marke: Invitrogen™ RP88965

Bitte Sie sich an, um diesen Artikel zu kaufen. Sie benötigen ein Web-Konto? Registrieren Sie sich noch heute!

Dieser Artikel kann nicht zurückgegeben werden. Rückgaberichtlinie anzeigen

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (97%), Rat (97%). This recombinant protein control fragment may be used for blocking experiments. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

This gene encodes the cyclic-GMP (cGMP)-specific phosphodiesterase 6A alpha subunit, expressed in cells of the retinal rod outer segment. The phosphodiesterase 6 holoenzyme is a heterotrimer composed of an alpha, beta, and two gamma subunits. cGMP is an important regulator of rod cell membrane current, and its dynamic concentration is established by phosphodiesterase 6A cGMP hydrolysis and guanylate cyclase cGMP synthesis. The protein is a subunit of a key phototransduction enzyme and participates in processes of transmission and amplification of the visual signal. Mutations in this gene have been identified as one cause of autosomal recessive retinitis pigmentosa.
TRUSTED_SUSTAINABILITY

Spezifikation

Zugriffsnummer P16499
Konzentration ≥5.0 mg/mL
Zur Verwendung mit (Anwendung) Blocking Assay, Control
Zusammensetzung 1 M urea, PBS with no preservative; pH 7.4
Gen-ID (Entrez) 5145
Name Human PDE6A (aa 418-560) Control Fragment
Menge 100 μl
Kennzeichnung RUO
Gen-Alias cGMP phosphodiesterase alpha; cGMP phosphodiesterase alpha subunit; cGMP phosphodiesterase alpha subunit (EC 3.1.4.35); CGPR-A; cyclic GMP phosphodiesterase alpha subunit; GMP phosphodiesterase alpha subunit; GMP-PDE alpha; nmf282; PDE V-B1; PDE6A; PDEA; phosphodiesterase 6 A; phosphodiesterase 6 A, cGMP-specific, rod, alpha; phosphodiesterase, cyclic GMP (rod receptor), alpha polypeptide; rod cGMP-specific 3',5'-cyclic phosphodiesterase subunit alpha; rod photoreceptor cGMP phosphodiesterase alpha subunit; RP43; unnamed protein product
Gebräuchliche Bezeichnung PDE6A
Gensymbol PDE6A
Konjugat Unconjugated
Spezies Human
Rekombinant Recombinant
Proteinmarkierung His-ABP-tag
Sequenz TLMESLTQFLGWSVLNPDTYESMNKLENRKDIFQDIVKYHVKCDNEEIQKILKTREVYGKEPWECEEEELAEILQAELPDADKYEINKFHFSDLPLTELELVKCGIQMYYELKVVDKFHIPQEALVRFMYSLSKGYRKITYHN
Inhalt und Lagerung -20°C, Avoid Freeze/Thaw Cycles
Expressionssystem E. coli
Form Liquid
Reinheits- oder Qualitätsgrad >80% by SDS-PAGE and Coomassie blue staining
Mehr anzeigen Weniger anzeigen
Name des Produkts
Wählen Sie ein Thema

Indem Sie auf Absenden klicken, erklären Sie sich damit einverstanden, dass Fisher Scientific sich mit Ihnen in Verbindung setzen kann, um Ihr Feedback in diesem Formular zu bearbeiten. Wir werden Ihre Informationen nicht für andere Zwecke weitergeben. Alle bereitgestellten Kontaktinformationen werden in Übereinstimmung mit unserer Datenschutzrichtlinie aufbewahrt. Datenschutzrichtlinie.