missing translation for 'onlineSavingsMsg'
Learn More

Invitrogen™ Human PRMT5 (aa 345-456) Control Fragment Recombinant Protein

Artikelnummer. 30208590
Change view
Click to view available options
Menge:
100 μl
Packungsgröße:
100 Mikroliter
Artikelnummer. Menge unitSize
30208590 100 μl 100 Mikroliter
1 options
Dieser Artikel kann nicht zurückgegeben werden. Rückgaberichtlinie anzeigen

Artikelnummer. 30208590

Marke: Invitrogen™ RP89031

Bitte Sie sich an, um diesen Artikel zu kaufen. Sie benötigen ein Web-Konto? Registrieren Sie sich noch heute!

Dieser Artikel kann nicht zurückgegeben werden. Rückgaberichtlinie anzeigen

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (97%), Rat (97%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-82194 (PA5-82194. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

PRMT5 (protein arginine N-methyltransferase 5) is an arginine methyltransferase that can both catalyze the formation of omega-N monomethylarginine (MMA) and symmetrical dimethylarginine (sDMA), with a preference for the formation of MMA. PRMT5 specifically mediates the symmetrical dimethylation of arginine residues in the small nuclear ribonucleoproteins Sm D1 and Sm D3; such methylation is required for the assembly and biogenesis of snRNP core particles.
TRUSTED_SUSTAINABILITY

Spezifikation

Zugriffsnummer O14744
Konzentration ≥5.0 mg/mL
Zur Verwendung mit (Anwendung) Blocking Assay, Control
Zusammensetzung 1 M urea, PBS with no preservative; pH 7.4
Gen-ID (Entrez) 10419
Name Human PRMT5 (aa 345-456) Control Fragment
Menge 100 μl
Kennzeichnung RUO
Gen-Alias 72 kDa ICln-binding protein; EC 2.1.1.125; histone-arginine N-methyltransferase PRMT5; HMT1 hnRNP methyltransferase-like 5; HRMT1L5; hypothetical protein; I79_013398; IBP72; Jak-binding protein 1; JBP1; PRMT5; protein arginine methyltransferase 5; protein arginine N-methyltransferase 5; Protein arginine N-methyltransferase 5, N-terminally processed; protein arginine N-methyltransferase 5-like; shk1 kinase-binding protein 1 homolog; Skb1; SKB1 homolog; SKB1Hs
Gebräuchliche Bezeichnung PRMT5
Gensymbol PRMT5
Konjugat Unconjugated
Spezies Human
Rekombinant Recombinant
Proteinmarkierung His-ABP-tag
Sequenz LLDRVPEEEKDTNVQVLMVLGAGRGPLVNASLRAAKQADRRIKLYAVEKNPNAVVTLENWQFEEWGSQVTVVSSDMREWVAPEKADIIVSELLGSFADNELSPECLDGAQHF
Inhalt und Lagerung -20°C, Avoid Freeze/Thaw Cycles
Expressionssystem E. coli
Form Liquid
Reinheits- oder Qualitätsgrad >80% by SDS-PAGE and Coomassie blue staining
Mehr anzeigen Weniger anzeigen
Name des Produkts
Wählen Sie ein Thema

Indem Sie auf Absenden klicken, erklären Sie sich damit einverstanden, dass Fisher Scientific sich mit Ihnen in Verbindung setzen kann, um Ihr Feedback in diesem Formular zu bearbeiten. Wir werden Ihre Informationen nicht für andere Zwecke weitergeben. Alle bereitgestellten Kontaktinformationen werden in Übereinstimmung mit unserer Datenschutzrichtlinie aufbewahrt. Datenschutzrichtlinie.