missing translation for 'onlineSavingsMsg'
Learn More
  1. Home
  2. Products
  3. Rekombinante Proteine
  4. 30211898

Invitrogen™ Human RCSD1 (aa 1-51) Control Fragment Recombinant Protein

Código de producto. 30211898
Click to view available options
Menge:
100 μl
Tamaño de la unidad:
100 Mikroliter
Este artículo no se puede devolver. Vea la política de devoluciones

Código de producto. 30211898

Marca: Invitrogen™ RP109350

om dit product te kopen Registreer vandaag om een webaccount aan te maken

Este artículo no se puede devolver. Vea la política de devoluciones

Descripción

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (86%), Rat (86%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-139917 (PA5-139917. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

Stress-induced phosphorylation of CAPZIP may regulate the ability of F-actin-capping protein to remodel actin filament assembly.
TRUSTED_SUSTAINABILITY

Especificaciones

Zugriffsnummer Q6JBY9
Konzentration ≥5.0 mg/mL
Zur Verwendung mit (Anwendung) Blocking Assay, Control
Zusammensetzung 1 M urea, PBS with no preservative; pH 7.4
Gen-ID (Entrez) 92241
Name Human RCSD1 (aa 1-51) Control Fragment
Menge 100 μl
Kennzeichnung RUO
Gen-Alias CapZ interacting protein; capZ-interacting protein; CAPZIP; MK2S4; Protein kinase substrate CapZIP; protein kinase substrate MK2S4; RCSD domain containing 1; RCSD domain-containing protein 1; RCSD1
Gebräuchliche Bezeichnung RCSD1
Gensymbol RCSD1
Konjugat Unconjugated
Spezies Human
Rekombinant Recombinant
Proteinmarkierung His-ABP-tag
Sequenz MEERPAETNANVDNSASPSVAQLAGRFREQAAAAKETPASKPTRRKPPCSL
Inhalt und Lagerung -20°C, Avoid Freeze/Thaw Cycles
Expressionssystem E. coli
Form Liquid
Reinheits- oder Qualitätsgrad >80% by SDS-PAGE and Coomassie blue staining
Mostrar más Mostrar menos
Corrección del contenido de un producto

Proporcione sus comentarios sobre el contenido del producto rellenando el siguiente formulario.

Título del producto

Al hacer clic en Enviar, acepta que Fisher Scientific se ponga en contacto con usted en relación con los comentarios que ha proporcionado en este formulario. No compartiremos su información para ningún otro fin. Toda la información de contacto proporcionada se mantendrá de acuerdo con nuestra Política de Privacidad. Política de privacidad.

Gracias por ayudarnos a mejorar nuestra web. Su comentario ha sido enviado