missing translation for 'onlineSavingsMsg'
Learn More
  1. Home
  2. Products
  3. Rekombinante Proteine
  4. 30210271

Invitrogen™ Human SAA4 (aa 25-63) Control Fragment Recombinant Protein

Artikelnummer. 30210271
Change view
Click to view available options
Menge:
100 μl
Unit Size:
100 Mikroliter
Product Code. Menge unitSize
30210271 100 μl 100 Mikroliter
1 options
This item is not returnable. View return policy

Product Code. 30210271

Brand: Invitrogen™ RP100823

Bitte Sie sich an, um diesen Artikel zu kaufen. Sie benötigen ein Web-Konto? Registrieren Sie sich noch heute!

This item is not returnable. View return policy

Description

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (59%), Rat (59%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-63819 (PA5-63819. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

SAA4 is a major acute phase reactant. It is an Apolipoprotein of the HDL complex.
TRUSTED_SUSTAINABILITY

Specifications

Zugriffsnummer P35542
Konzentration ≥5.0 mg/mL
Zur Verwendung mit (Anwendung) Blocking Assay, Control
Zusammensetzung 1 M urea, PBS with no preservative; pH 7.4
Gen-ID (Entrez) 6291
Name Human SAA4 (aa 25-63) Control Fragment
Menge 100 μl
Kennzeichnung RUO
Gen-Alias amyloid A-5 protein; Constitutively expressed serum amyloid A protein; CSAA; C-SAA; Saa4; Saa-4; Saa5; Saa-5; serum amyloid A 4; serum amyloid A-4 protein; serum amyloid A4, constitutive
Gebräuchliche Bezeichnung SAA4
Gensymbol Saa4
Konjugat Unconjugated
Spezies Human
Rekombinant Recombinant
Proteinmarkierung His-ABP-tag
Sequenz FKEALQGVGDMGRAYWDIMISNHQNSNRYLYARGNYDAA
Inhalt und Lagerung -20°C, Avoid Freeze/Thaw Cycles
Expressionssystem E. coli
Form Liquid
Reinheits- oder Qualitätsgrad >80% by SDS-PAGE and Coomassie blue staining
Show More Show Less
Product Title
Select an issue

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.