missing translation for 'onlineSavingsMsg'
Learn More

Invitrogen™ Human SH3BP4 (aa 537-636) Control Fragment Recombinant Protein

Artikelnummer. 30206985
Change view
Click to view available options
Menge:
100 μl
Packungsgröße:
100 Mikroliter
1 product options available for selection
Product selection table with 1 available options. Use arrow keys to navigate and Enter or Space to select.
Artikelnummer. Menge unitSize
30206985 100 μl 100 Mikroliter
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 1 options available.
1 options
Dieser Artikel kann nicht zurückgegeben werden. Rückgaberichtlinie anzeigen
Artikelnummer. 30206985 Lieferant Invitrogen™ Lieferanten-Nr. RP102773

Please to purchase this item. Need a web account? Register with us today!

Dieser Artikel kann nicht zurückgegeben werden. Rückgaberichtlinie anzeigen

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (91%), Rat (91%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-57993 (PA5-57993. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

SH3BP4 was initially isolated as a novel cDNA using differential display analysis using cultured human corneal fibroblasts. The protein contains three Asn-Pro-Phe (NPF) motifs, an SH3 domain, a PXXP motif, a bipartite nuclear targeting signal, and a tyrosine phosphorylation site. SH3BP4 has been shown to interact with specific endocytic proteins such as clathrin, dynamin, and the transferrin receptor (TfR) and localizes to TfR-containing coated pits and vesicles. It is thought to be involved in cargo-specific control of clathrin-mediated endocytosis, specifically controlling the internalization of TfR. At least two isoforms of SH3BP4 are known to exist.
TRUSTED_SUSTAINABILITY

Spezifikation

Zugriffsnummer Q9P0V3
Konzentration ≥5.0 mg/mL
Zur Verwendung mit (Anwendung) Blocking Assay, Control
Zusammensetzung 1 M urea, PBS with no preservative; pH 7.4
Gen-ID (Entrez) 23677
Name Human SH3BP4 (aa 537-636) Control Fragment
Menge 100 μl
Kennzeichnung RUO
Gen-Alias AI594717; AW227605; BOG25; EHB10; EH-binding protein 10; SH3 domain binding protein 4; SH3 domain-binding protein 4; SH3 domain-binding protein 4; SH3-domain binding protein 4; Sh3bp4; SH3-domain binding protein 4; si:dkey-57b6.3; Transferrin receptor-trafficking protein; TTP
Gebräuchliche Bezeichnung SH3BP4
Gensymbol SH3BP4
Konjugat Unconjugated
Spezies Human
Rekombinant Recombinant
Proteinmarkierung His-ABP-tag
Sequenz LKVCMFSNMTNYEVKASEQAKVVRGFQLKLGKVSRLIFPITSQNPNELSDFTLRVQVKDDQEAILTQFCVQTPQPPPKSAIKPSGQRRFLKKNEVGKIIL
Inhalt und Lagerung -20°C, Avoid Freeze/Thaw Cycles
Expressionssystem E. coli
Form Liquid
Reinheits- oder Qualitätsgrad >80% by SDS-PAGE and Coomassie blue staining
Mehr anzeigen Weniger anzeigen
Name des Produkts
Wählen Sie ein Thema

Indem Sie auf Absenden klicken, erklären Sie sich damit einverstanden, dass Fisher Scientific sich mit Ihnen in Verbindung setzen kann, um Ihr Feedback in diesem Formular zu bearbeiten. Wir werden Ihre Informationen nicht für andere Zwecke weitergeben. Alle bereitgestellten Kontaktinformationen werden in Übereinstimmung mit unserer Datenschutzrichtlinie aufbewahrt. Datenschutzrichtlinie.