missing translation for 'onlineSavingsMsg'
Learn More

Invitrogen™ Human SHB (aa 340-400) Control Fragment Recombinant Protein

Artikelnummer. 30211365
Change view
Click to view available options
Menge:
100 μl
Packungsgröße:
100 Mikroliter
Artikelnummer. Menge unitSize
30211365 100 μl 100 Mikroliter
1 options
Dieser Artikel kann nicht zurückgegeben werden. Rückgaberichtlinie anzeigen

Artikelnummer. 30211365

Marke: Invitrogen™ RP106373

Bitte Sie sich an, um diesen Artikel zu kaufen. Sie benötigen ein Web-Konto? Registrieren Sie sich noch heute!

Dieser Artikel kann nicht zurückgegeben werden. Rückgaberichtlinie anzeigen

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (100%), Rat (100%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-65701 (PA5-65701. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

The SH2 (Src Homology 2) domain is a structurally conserved motif that contains two alpha helices and seven beta strands and is found in a variety of proteins that are involved in signal transduction throughout the cell. Specifically, the SH2 domain targets SH2 domain-containing proteins to tyrosinephosphorylated sites, an event that can trigger a protein-protein interaction cascade which may ultimately effect gene expression and cellular function. Shb (SH2 domain-containing adapter protein b), Shd (SH2 domain-containing adapter protein d), She (SH2 domain-containing adapter protein e) and Shf(SH2 domain-containing adapter protein f) are SH2 domain-containing proteins that play various roles throughout the cell.
TRUSTED_SUSTAINABILITY

Spezifikation

Zugriffsnummer Q15464
Konzentration ≥5.0 mg/mL
Zur Verwendung mit (Anwendung) Blocking Assay, Control
Zusammensetzung 1 M urea, PBS with no preservative; pH 7.4
Gen-ID (Entrez) 6461
Name Human SHB (aa 340-400) Control Fragment
Menge 100 μl
Kennzeichnung RUO
Gen-Alias bA3J10.2; BC028832; SH2 domain containing adaptor protein B; SH2 domain-containing adapter protein B; Shb; SHB (Src homology 2 domain containing) adaptor protein B; SHB adaptor protein (a Src homology 2 protein); Src homology 2 domain containing adaptor protein B; src homology 2 domain-containing transforming protein B
Gebräuchliche Bezeichnung SHB
Gensymbol SHB
Konjugat Unconjugated
Spezies Human
Rekombinant Recombinant
Proteinmarkierung His-ABP-tag
Sequenz WEWNRVTIPALAAQFNGNEKRQSSPSPSRDRRRQLRAPGGGFKPIKHGSPEFCGILGERVD
Inhalt und Lagerung -20°C, Avoid Freeze/Thaw Cycles
Expressionssystem E. coli
Form Liquid
Reinheits- oder Qualitätsgrad >80% by SDS-PAGE and Coomassie blue staining
Mehr anzeigen Weniger anzeigen
Name des Produkts
Wählen Sie ein Thema

Indem Sie auf Absenden klicken, erklären Sie sich damit einverstanden, dass Fisher Scientific sich mit Ihnen in Verbindung setzen kann, um Ihr Feedback in diesem Formular zu bearbeiten. Wir werden Ihre Informationen nicht für andere Zwecke weitergeben. Alle bereitgestellten Kontaktinformationen werden in Übereinstimmung mit unserer Datenschutzrichtlinie aufbewahrt. Datenschutzrichtlinie.