missing translation for 'onlineSavingsMsg'
Learn More
  1. Home
  2. Products
  3. Rekombinante Proteine
  4. 30209622

Invitrogen™ Human TREML1 (aa 28-157) Control Fragment Recombinant Protein

Artikelnummer. 30209622
Click to view available options
Menge:
100 μl
Packungsgröße:
100 Mikroliter
Dieser Artikel kann nicht zurückgegeben werden. Rückgaberichtlinie anzeigen

Artikelnummer. 30209622

Marke: Invitrogen™ RP90508

om dit product te kopen Registreer vandaag om een webaccount aan te maken

Dieser Artikel kann nicht zurückgegeben werden. Rückgaberichtlinie anzeigen

Description

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (68%), Rat (68%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-53647 (PA5-53647. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

TREML1 is located in a gene cluster on chromosome 6 with the single Ig variable domain activating receptors TREM1 and TREM2, but it has distinct structural and functional properties. TREML1 enhances calcium signaling in an SHP2 -dependent manner.
TRUSTED_SUSTAINABILITY

Specifications

Zugriffsnummer Q86YW5
Konzentration ≥5.0 mg/mL
Zur Verwendung mit (Anwendung) Blocking Assay, Control
Zusammensetzung 1 M urea, PBS with no preservative; pH 7.4
Gen-ID (Entrez) 340205
Name Human TREML1 (aa 28-157) Control Fragment
Menge 100 μl
Kennzeichnung RUO
Gen-Alias 5430401J17Rik; dJ238O23.3; GLTL1825; MGC119173; OTTHUMP00000017858; PRO3438; RGD1565175; Tlt1; TLT-1; TREM; TREML1; trem-like transcript 1 protein; Triggering receptor expressed on myeloid cells; triggering receptor expressed on myeloid cells like 1; triggering receptor expressed on myeloid cells-like 1; triggering receptor expressed on myeloid cells-like 1 c; triggering receptor expressed on myeloid cells-like 1 d; triggering receptor expressed on myeloid cells-like 1 e; triggering receptor expressed on myeloid cells-like protein 1; UNQ1825/PRO3438
Gebräuchliche Bezeichnung TREML1
Gensymbol TREML1
Konjugat Unconjugated
Spezies Human
Rekombinant Recombinant
Proteinmarkierung His-ABP-tag
Sequenz APVGSSILVQCHYRLQDVKAQKVWCRFLPEGCQPLVSSAVDRRAPAGRRTFLTDLGGGLLQVEMVTLQEEDAGEYGCMVDGARGPQILHRVSLNILPPEEEEETHKIGSLAENAFSDPAGSANPLEPSQD
Inhalt und Lagerung -20°C, Avoid Freeze/Thaw Cycles
Expressionssystem E. coli
Form Liquid
Reinheits- oder Qualitätsgrad >80% by SDS-PAGE and Coomassie blue staining
Show More Show Less
Product Content Correction

Your input is important to us. Please complete this form to provide feedback related to the content on this product.

Product Title

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.

Thank You! Your feedback has been submitted. Fisher Scientific is always working to improve our content for you. We appreciate your feedback.