missing translation for 'onlineSavingsMsg'
Learn More

Invitrogen™ Human TRMU (aa 114-181) Control Fragment Recombinant Protein

Artikelnummer. 30208187
Change view
Click to view available options
Menge:
100 μl
Packungsgröße:
100 Mikroliter
Artikelnummer. Menge unitSize
30208187 100 μl 100 Mikroliter
1 options
Dieser Artikel kann nicht zurückgegeben werden. Rückgaberichtlinie anzeigen

Artikelnummer. 30208187

Marke: Invitrogen™ RP104768

Bitte Sie sich an, um diesen Artikel zu kaufen. Sie benötigen ein Web-Konto? Registrieren Sie sich noch heute!

Dieser Artikel kann nicht zurückgegeben werden. Rückgaberichtlinie anzeigen

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (94%), Rat (94%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-65354 (PA5-65354. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

Catalyzes the 2-thiolation of uridine at the wobble position (U34) of mitochondrial tRNA(Lys), tRNA(Glu) and tRNA(Gln). Required for the formation of 5-taurinomethyl-2- thiouridine (tm5s2U) of mitochondrial tRNA(Lys), tRNA(Glu), and tRNA(Gln) at the wobble position. ATP is required to activate the C2 atom of the wobble base.
TRUSTED_SUSTAINABILITY

Spezifikation

Zugriffsnummer O75648
Konzentration ≥5.0 mg/mL
Zur Verwendung mit (Anwendung) Blocking Assay, Control
Zusammensetzung 1 M urea, PBS with no preservative; pH 7.4
Gen-ID (Entrez) 55687
Name Human TRMU (aa 114-181) Control Fragment
Menge 100 μl
Kennzeichnung RUO
Gen-Alias 1110005N20Rik; 1600025P05Rik; AI314320; LCAL3; lung cancer associated lncRNA 3; mitochondrial 5-methylaminomethyl-2-thiouridylate-methyltransferase; mitochondrial tRNA-specific 2-thiouridylase 1; MTO2; MTO2 homolog; MTU1; TRMT; Trmt1; Trmu; tRNA (5-methylaminomethyl-2-thiouridylate)-methyltransferase 1; tRNA 5-methylaminomethyl-2-thiouridylate methyltransferase; tRNA mitochondrial 2-thiouridylase; TRNT1
Gebräuchliche Bezeichnung TRMU
Gensymbol TRMU
Konjugat Unconjugated
Spezies Human
Rekombinant Recombinant
Proteinmarkierung His-ABP-tag
Sequenz AVDNLGADAIATGHYARTSLEDEEVFEQKHVKKPEGLFRNRFEVRNAVKLLQAADSFKDQTFFLSQVS
Inhalt und Lagerung -20°C, Avoid Freeze/Thaw Cycles
Expressionssystem E. coli
Form Liquid
Reinheits- oder Qualitätsgrad >80% by SDS-PAGE and Coomassie blue staining
Mehr anzeigen Weniger anzeigen
Name des Produkts
Wählen Sie ein Thema

Indem Sie auf Absenden klicken, erklären Sie sich damit einverstanden, dass Fisher Scientific sich mit Ihnen in Verbindung setzen kann, um Ihr Feedback in diesem Formular zu bearbeiten. Wir werden Ihre Informationen nicht für andere Zwecke weitergeben. Alle bereitgestellten Kontaktinformationen werden in Übereinstimmung mit unserer Datenschutzrichtlinie aufbewahrt. Datenschutzrichtlinie.