missing translation for 'onlineSavingsMsg'
Learn More

Invitrogen™ Human USP11 (aa 89-216) Control Fragment Recombinant Protein

Artikelnummer. 30211003
Click to view available options
Menge:
100 μl
Packungsgröße:
100 Mikroliter
Dieser Artikel kann nicht zurückgegeben werden. Rückgaberichtlinie anzeigen

Artikelnummer. 30211003

Marke: Invitrogen™ RP92187

Bitte Sie sich an, um diesen Artikel zu kaufen. Sie benötigen ein Web-Konto? Registrieren Sie sich noch heute!

Dieser Artikel kann nicht zurückgegeben werden. Rückgaberichtlinie anzeigen

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (77%), Rat (77%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-82061 (PA5-82061. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

USP11 (ubiquitin specific peptidase 11), also known as UHX1, is a 920 amino acid deubiquitinating enzyme that participates in the Ub pathway. Localized to the nucleus, USP11 associates with both Ran BP-M (Ran binding protein M) and with the tumor suppressor BRCA2. Through these associations, USP11 functions to either inhibit ubiquitination of these proteins or to remove ubiquitin residues that have already been attached to these proteins. USP11 is implicated in several X-linked retinal diseases and, due to its ability to deubiquitinate BRCA2, may play a role in tumor suppression.
TRUSTED_SUSTAINABILITY

Spezifikation

Zugriffsnummer P51784
Konzentration ≥5.0 mg/mL
Zur Verwendung mit (Anwendung) Blocking Assay, Control
Zusammensetzung 1 M urea, PBS with no preservative; pH 7.4
Gen-ID (Entrez) 8237
Name Human USP11 (aa 89-216) Control Fragment
Menge 100 μl
Kennzeichnung RUO
Gen-Alias 6230415D12Rik; deubiquitinating enzyme 11; mKIAA4085; RP4-659F15.2; Ubiquitin carboxyl-terminal hydrolase 11; ubiquitin carboxyl-terminal hydrolase, X-linked; ubiquitin specific peptidase 11; ubiquitin specific protease 11; ubiquitin thioesterase 11; ubiquitin thiolesterase 11; ubiquitin-specific processing protease 11; ubiquitin-specific-processing protease 11; UHX1; USP11
Gebräuchliche Bezeichnung USP11
Gensymbol USP11
Konjugat Unconjugated
Spezies Human
Rekombinant Recombinant
Proteinmarkierung His-ABP-tag
Sequenz ESGRERPLRAGESWFLVEKHWYKQWEAYVQGGDQDSSTFPGCINNATLFQDEINWRLKEGLVEGEDYVLLPAAAWHYLVSWYGLEHGQPPIERKVIELPNIQKVEVYPVELLLVRHNDLGKSHTVQFS
Inhalt und Lagerung -20°C, Avoid Freeze/Thaw Cycles
Expressionssystem E. coli
Form Liquid
Reinheits- oder Qualitätsgrad >80% by SDS-PAGE and Coomassie blue staining
Mehr anzeigen Weniger anzeigen
Berichtigung von Produktinhalten

Bitte geben Sie uns Ihr Feedback zu den Produktinhalten, indem Sie das folgende Formular ausfüllen.

Name des Produkts

Indem Sie auf Absenden klicken, erklären Sie sich damit einverstanden, dass Fisher Scientific sich mit Ihnen in Verbindung setzen kann, um Ihr Feedback in diesem Formular zu bearbeiten. Wir werden Ihre Informationen nicht für andere Zwecke weitergeben. Alle bereitgestellten Kontaktinformationen werden in Übereinstimmung mit unserer Datenschutzrichtlinie aufbewahrt. Datenschutzrichtlinie.

Vielen Dank, dass Sie uns helfen, unsere Website zu verbessern. Ihr Feedback wurde übermittelt