missing translation for 'onlineSavingsMsg'
Learn More
Learn More
ID3 Antibody (3E10), Novus Biologicals™
Mouse Monoclonal Antibody
Marke: Novus Biologicals H00003399-M02
Dieser Artikel kann nicht zurückgegeben werden.
Rückgaberichtlinie anzeigen
Beschreibung
ID3 Monoclonal antibody specifically detects ID3 in Human samples. It is validated for Western Blot, ELISA, Immunocytochemistry/ Immunofluorescence
Spezifikation
| ID3 | |
| Monoclonal | |
| Unconjugated | |
| In 1x PBS, pH 7.4 | |
| BHLHB25, bHLHb251R21, Class B basic helix-loop-helix protein 25, DNA-binding protein inhibitor ID-3, HEIR1, HEIR-1, Helix-loop-helix protein HEIR-1, ID-like protein inhibitor HLH 1R21, Inhibitor of DNA binding 3, inhibitor of DNA binding 3, dominant negative helix-loop-helix protein | |
| ID3 (NP_002158, 1 a.a. ~ 83 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. MKALSPVRGCYEAVCCLSERSLAIARGRGKGPAAEEPLSLLDDMNHCYSRLRELVPGVPRGTQLSQVEILQRVIDYILDLQVV | |
| 0.1 mg | |
| Cancer, Cell Cycle and Replication, Prostate Cancer | |
| 3399 | |
| Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles. | |
| IgG3 κ |
| Western Blot, ELISA, Immunocytochemistry | |
| 3E10 | |
| Western Blot 1:500, ELISA, Immunocytochemistry/ Immunofluorescence | |
| NP_002158 | |
| Mouse | |
| IgG purified | |
| RUO | |
| Primary | |
| Human | |
| Purified |
Berichtigung von Produktinhalten
Bitte geben Sie uns Ihr Feedback zu den Produktinhalten, indem Sie das folgende Formular ausfüllen.
Name des Produkts
Haben Sie Verbesserungsvorschläge?Übermitteln Sie eine inhaltliche Korrektur