missing translation for 'onlineSavingsMsg'
Learn More
Learn More
Novus Biologicals™ IkB-beta Recombinant Protein Antigen
Alle ansehen Bio Techne Produkte
Click to view available options
Menge:
100 μl
Packungsgröße:
100 Mikroliter
Beschreibung
A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human IkB-beta. Source: E.coli Amino Acid Sequence: EEDWKLQLEAENYEGHTPLHVAVIHKDVEMVRLLRDAGADLDKPEPTCGRSPLHLAVEAQAADVL The IkB-beta Recombinant Protein Antigen is derived from E. coli. The IkB-beta Recombinant Protein Antigen has been validated for the following applications: Antibody Competition.
Spezifikation
Spezifikation
| Gene ID (Entrez) | 4793 |
| Reinigungsverfahren | >80% by SDS-PAGE and Coomassie blue staining |
| Gebräuchliche Bezeichnung | IkB-beta Recombinant Protein Antigen |
| Inhalt und Lagerung | Store at −20°C. Avoid freeze-thaw cycles. |
| Zusammensetzung | PBS and 1M Urea, pH 7.4. |
| Zur Verwendung mit (Anwendung) | Blocking/Neutralizing, Control |
| Gen-Alias | beta, IkappaBbeta, I-kappa-B-beta, IkB-B, IkB-beta, IKBBikB-beta, NF-kappa-B inhibitor beta, NF-kappa-BIB, nuclear factor of kappa light polypeptide gene enhancer in B-cells inhibitor, Thyroid receptor-interacting protein 9, TR-interacting protein 9, TRIP |
| Gensymbol | NFKBIB |
| Markertyp | Unmarkiert |
| Produkttyp | Recombinant Protein Antigen |
| Mehr anzeigen |
Nur für Forschungszwecke.
Berichtigung von Produktinhalten
Bitte geben Sie uns Ihr Feedback zu den Produktinhalten, indem Sie das folgende Formular ausfüllen.
Name des Produkts
Haben Sie Verbesserungsvorschläge?Übermitteln Sie eine inhaltliche Korrektur