missing translation for 'onlineSavingsMsg'
Learn More
  1. Home
  2. Products
  3. Antikörper
  4. Primärantikörper
  5. Alle Primärantikörper
  6. IL-10R alpha Antibody, Novus Biologicals™

IL-10R alpha Antibody, Novus Biologicals™

Artikelnummer. 18604135 Alle ansehen Bio Techne Produkte
Change view
Click to view available options
Menge:
100 μg
25 μg
Packungsgröße:
100 Mikroliter
25 Mikroliter
Artikelnummer. Menge unitSize
18604135 25 μg 25 Mikroliter
18654474 100 μg 100 Mikroliter
2 options
Dieser Artikel kann nicht zurückgegeben werden. Rückgaberichtlinie anzeigen

Artikelnummer. 18604135

Marke: Novus Biologicals NBP32132425ul

Bitte Sie sich an, um diesen Artikel zu kaufen. Sie benötigen ein Web-Konto? Registrieren Sie sich noch heute!

Dieser Artikel kann nicht zurückgegeben werden. Rückgaberichtlinie anzeigen

Description

Rabbit Polyclonal Antibody

IL-10R alpha Polyclonal antibody specifically detects IL-10R alpha in Human samples. It is validated for Immunofluorescence
TRUSTED_SUSTAINABILITY

Specifications

Antigen IL-10R alpha
Anwendungen Immunofluorescence
Klassifikation Polyclonal
Konjugat Unconjugated
Verdünnung Immunocytochemistry/Immunofluorescence 0.25-2 ug/ml
Zusammensetzung PBS, pH 7.2, 40% glycerol
Gen-Alias CD210 antigen, CDw210a, HIL-10R, IBD28, IL-10 receptor subunit alpha, IL-10R subunit 1, IL-10R1, IL-10RA, IL10RIL-10R subunit alpha, interleukin 10 receptor, alpha, interleukin-10 receptor alpha chain, Interleukin-10 receptor subunit 1, interleukin-10 receptor subunit alpha
Wirtsspezies Rabbit
Immunogen This antibody was developed against Recombinant Protein corresponding to amino acids: HGTELPSPPSVWFEAEFFHHILHWTPIPNQSESTCYEVALLRYGIESWNSISNCSQTLSYDL
Reinigungsverfahren Affinity purified
Menge 25 μg
Regulatorischer Status RUO
Forschungsgebiet Cytokine Research
Primär oder sekundär Primary
Gen-ID (Entrez) 3587
Zielspezies Human
Inhalt und Lagerung Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Form Purified
Isotype IgG
Show More Show Less
Product Title
Select an issue

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.