missing translation for 'onlineSavingsMsg'
Learn More
  1. Home
  2. Products
  3. Antikörper
  4. Primärantikörper
  5. Alle Primärantikörper
  6. Integrin alpha 5/CD49e Antibody (CL6945), Novus Biologicals™

Integrin alpha 5/CD49e Antibody (CL6945), Novus Biologicals™

Artikelnummer. 18606381 Alle ansehen Bio Techne Produkte
Ansicht ändern
Click to view available options
Menge:
25 μL
100 μL
Packungsgröße:
100 Mikroliter
25 Mikroliter
2 product options available for selection
Product selection table with 2 available options. Use arrow keys to navigate and Enter or Space to select.
Product Code. Menge unitSize
18606381 25 μL 25 Mikroliter
18340721 100 μL 100 Mikroliter
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 2 options available.
2 options
This item is not returnable. View return policy
Product Code. 18606381 Supplier Novus Biologicals Supplier No. NBP27651925ul

Please to purchase this item. Need a web account? Register with us today!

This item is not returnable. View return policy

Description

Mouse Monoclonal Antibody

Integrin alpha 5/CD49e Monoclonal specifically detects Integrin alpha 5/CD49e in Human samples. It is validated for Immunohistochemistry, Immunohistochemistry-Paraffin.
TRUSTED_SUSTAINABILITY

Specifications

Antigen Integrin alpha 5/CD49e
Anwendungen Immunohistochemistry, Immunohistochemistry (Paraffin)
Klassifikation Monoclonal
Klon CL6945
Konjugat Unconjugated
Verdünnung Immunohistochemistry 1:500 - 1:1000, Immunohistochemistry-Paraffin 1:500 - 1:1000
Zusammensetzung PBS, pH 7.2, containing 40% glycerol with 0.02% sodium azide
Gen-Alias CD49 antigen-like family member E, CD49e, CD49e antigen, Fibronectin receptor subunit alpha, fibronectin receptor, alpha subunit, FNRAVLA5A, integrin alpha-5, Integrin alpha-F, integrin, alpha 5 (fibronectin receptor, alpha polypeptide), very late activation protein 5, alpha subunit, VLA-5
Gensymbole ITGA5
Wirtsspezies Mouse
Immunogen This antibody was developed against Recombinant Protein corresponding to amino acids: DQPQKEEDLGPAVHHVYELINQGPSSISQGVLELSCPQALEGQQLLYVTRVTGLNCTTNHPINPKGLELDPEGSLHHQQKREAPSRSSASSGPQILKCPEAECFRLRCELGPLHQQESQSLQLHFRVWA
Menge 25 μL
Regulatorischer Status RUO
Primär oder sekundär Primary
Gen-ID (Entrez) 3678
Testspezifität Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Zielspezies Human
Inhalt und Lagerung Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles.
Form Purified
Isotype IgG1
Show More Show Less
Product Title
Select an issue

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.