missing translation for 'onlineSavingsMsg'
Learn More
Learn More
Jak2 Antibody, Novus Biologicals™
Rabbit Polyclonal Antibody
Marke: Novus Biologicals NBP2-55362
Dieser Artikel kann nicht zurückgegeben werden.
Rückgaberichtlinie anzeigen
Beschreibung
Jak2 Polyclonal specifically detects Jak2 in Human samples. It is validated for Western Blot, Immunocytochemistry/Immunofluorescence.
Spezifikation
| Jak2 | |
| Polyclonal | |
| Western Blot 0.4 ug/ml, Immunocytochemistry/Immunofluorescence 1-4 ug/ml | |
| EC 2.7.10, EC 2.7.10.2, JAK-2, Janus kinase 2Janus kinase 2 (a protein tyrosine kinase), JTK10, tyrosine-protein kinase JAK2 | |
| Rabbit | |
| Affinity Purified | |
| RUO | |
| Primary | |
| Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins. | |
| Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
| Western Blot, Immunocytochemistry, Immunofluorescence | |
| Unconjugated | |
| PBS, pH 7.2, containing 40% glycerol with 0.02% Sodium Azide | |
| JAK2 | |
| This antibody was developed against a recombinant protein corresponding to the following amino acid sequence:TGLYVLRCSPKDFNKYFLTFAVERENVIEYKHCLITKNENEEYNLSGTKKNFSSLKDLLNCYQMETVRSDNIIFQFTKCCPPKPKDKSN | |
| 100 μL | |
| Cell Cycle and Replication, Signal Transduction | |
| 3717 | |
| Human | |
| IgG |
Berichtigung von Produktinhalten
Bitte geben Sie uns Ihr Feedback zu den Produktinhalten, indem Sie das folgende Formular ausfüllen.
Name des Produkts
For Research Use Only
Haben Sie Verbesserungsvorschläge?Übermitteln Sie eine inhaltliche Korrektur