missing translation for 'onlineSavingsMsg'
Learn More
Learn More
Kv5.1 Antibody, Novus Biologicals™
Rabbit Polyclonal Antibody
Marke: Novus Biologicals NBP2-62639
Dieser Artikel kann nicht zurückgegeben werden.
Rückgaberichtlinie anzeigen
Beschreibung
Kv5.1 Polyclonal antibody specifically detects Kv5.1 in Human samples. It is validated for Immunohistochemistry, Immunohistochemistry (Paraffin)
Spezifikation
| Kv5.1 | |
| Polyclonal | |
| Immunohistochemistry 1:1000 - 1:2500, Immunohistochemistry-Paraffin 1:1000 - 1:2500 | |
| IK8, kH1, KV5.1, MGC33316, potassium channel KH1, potassium channel Kv5.1, potassium voltage-gated channel subfamily F member 1, potassium voltage-gated channel, subfamily F, member 1, voltage-gated potassium channel subunit Kv5.1 | |
| This antibody was developed against a recombinant protein corresponding to amino acids: PICFKNEMDFWKVDLKFLDDCCKSHLSEKREELEEIARRVQLILDDLGVDA | |
| 100 μg | |
| Signal Transduction | |
| 3754 | |
| Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles. | |
| IgG |
| Immunohistochemistry, Immunohistochemistry (Paraffin) | |
| Unconjugated | |
| PBS (pH 7.2) and 40% Glycerol | |
| Rabbit | |
| Protein A purified | |
| RUO | |
| Primary | |
| Human | |
| Purified |
Berichtigung von Produktinhalten
Bitte geben Sie uns Ihr Feedback zu den Produktinhalten, indem Sie das folgende Formular ausfüllen.
Name des Produkts
Haben Sie Verbesserungsvorschläge?Übermitteln Sie eine inhaltliche Korrektur