missing translation for 'onlineSavingsMsg'
Learn More
  1. Home
  2. Products
  3. Antikörper
  4. Primärantikörper
  5. Alle Primärantikörper
  6. LIR-8/CD85c/LILRB5 Antibody, Novus Biologicals™

LIR-8/CD85c/LILRB5 Antibody, Novus Biologicals™

Artikelnummer. 18490681 Alle ansehen Bio Techne Produkte
Change view
Click to view available options
Menge:
25 μL
0.1 mL
Unit Size:
0.10 Milliliter
25 Mikroliter
2 product options available for selection
Product selection table with 2 available options. Use arrow keys to navigate and Enter or Space to select.
Product Code. Menge unitSize
18490681 25 μL 25 Mikroliter
18247946 0.1 mL 0.10 Milliliter
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 2 options available.
2 options
This item is not returnable. View return policy
Product Code. 18490681 Supplier Novus Biologicals Supplier No. NBP18457525ul

Please to purchase this item. Need a web account? Register with us today!

This item is not returnable. View return policy

Description

Rabbit Polyclonal Antibody

LIR-8/CD85c/LILRB5 Polyclonal specifically detects LIR-8/CD85c/LILRB5 in Human samples. It is validated for Western Blot, Immunohistochemistry, Immunohistochemistry-Paraffin.
TRUSTED_SUSTAINABILITY

Specifications

Antigen LIR-8/CD85c/LILRB5
Anwendungen Immunohistochemistry, Immunohistochemistry (Paraffin)
Klassifikation Polyclonal
Konjugat Unconjugated
Verdünnung Immunohistochemistry 1:50 - 1:200, Immunohistochemistry-Paraffin 1:20-1:50
Zusammensetzung PBS (pH 7.2) and 40% Glycerol with 0.02% Sodium Azide
Gen-Alias CD85 antigen-like family member C, CD85c, CD85c antigen, Leukocyte immunoglobulin-like receptor 8, leukocyte immunoglobulin-like receptor, subfamily B (with TM and ITIM domains), LIR8CD85C, LIR-8leukocyte immunoglobulin-like receptor subfamily B member 5, member 5
Gensymbole LILRB5
Wirtsspezies Rabbit
Immunogen This antibody was developed against Recombinant Protein corresponding to amino acids:PKPTLWAEPASVIARGKPVTLWCQGPLETEEYRLDKEGLPWARKRQNPLEPGAKAKFHIPSTVYDSAGRYRCYYETPAGWSEPSDPLELVATG
Reinigungsverfahren Affinity Purified
Menge 25 μL
Regulatorischer Status RUO
Primär oder sekundär Primary
Gen-ID (Entrez) 10990
Testspezifität Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Zielspezies Human
Inhalt und Lagerung Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Isotype IgG
Show More Show Less

For Research Use Only

Product Title
Select an issue

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.