missing translation for 'onlineSavingsMsg'
Learn More
  1. Home
  2. Products
  3. Antikörper
  4. Primärantikörper
  5. Alle Primärantikörper
  6. 18524841

LRIT3 Antibody (3E7), Novus Biologicals™

Artikelnummer. 18524841 Alle ansehen Bio Techne Produkte
Change view
Click to view available options
Menge:
0.1 mg
Packungsgröße:
0.10 Milligramm
1 product options available for selection
Product selection table with 1 available options. Use arrow keys to navigate and Enter or Space to select.
Artikelnummer. Menge unitSize
18524841 0.1 mg 0.10 Milligramm
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 1 options available.
1 options
Dieser Artikel kann nicht zurückgegeben werden. Rückgaberichtlinie anzeigen
Artikelnummer. 18524841 Lieferant Novus Biologicals Lieferanten-Nr. H00345193M09

Please to purchase this item. Need a web account? Register with us today!

Dieser Artikel kann nicht zurückgegeben werden. Rückgaberichtlinie anzeigen

Beschreibung

Mouse Monoclonal Antibody

LRIT3 Monoclonal antibody specifically detects LRIT3 in Human samples. It is validated for Western Blot, ELISA, Immunohistochemistry, Immunohistochemistry (Paraffin)
TRUSTED_SUSTAINABILITY

Spezifikation

Antigen LRIT3
Anwendungen Western Blot, ELISA, Immunohistochemistry, Immunohistochemistry (Paraffin)
Klassifikation Monoclonal
Klon 3E7
Konjugat Unconjugated
Verdünnung Western Blot 1:500, ELISA, Immunohistochemistry, Immunohistochemistry-Paraffin
Zusammensetzung In 1x PBS, pH 7.4
Gen-Zugriffsnummer NP_940908
Gen-Alias fibronectin type III, immunoglobulin and leucine rich repeat domains 4, FIGLER4, FLJ44691, leucine-rich repeat, immunoglobulin-like and transmembrane domains 3, leucine-rich repeat, immunoglobulin-like domain and transmembranedomain-containing protein 3, MGC120618
Wirtsspezies Mouse
Immunogen LRIT3 (NP_940908, 422 a.a. ∽ 496 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. KVCKLQCKSEPFWEDDLAKETYIQFETLFPRSQSVGELWTRSHRDDSEKLLLCSRSSVESQVTFKSEGSRPEYYC
Reinigungsverfahren IgG purified
Menge 0.1 mg
Regulatorischer Status RUO
Primär oder sekundär Primary
Gen-ID (Entrez) 345193
Zielspezies Human
Inhalt und Lagerung Aliquot and store at -20°C or -80°C. Avoid freeze-thaw cycles.
Form Purified
Isotype IgG2a κ
Mehr anzeigen Weniger anzeigen
Name des Produkts
Wählen Sie ein Thema

Indem Sie auf Absenden klicken, erklären Sie sich damit einverstanden, dass Fisher Scientific sich mit Ihnen in Verbindung setzen kann, um Ihr Feedback in diesem Formular zu bearbeiten. Wir werden Ihre Informationen nicht für andere Zwecke weitergeben. Alle bereitgestellten Kontaktinformationen werden in Übereinstimmung mit unserer Datenschutzrichtlinie aufbewahrt. Datenschutzrichtlinie.