missing translation for 'onlineSavingsMsg'
Learn More
Learn More
MOGAT3 Antibody (3F7), Novus Biologicals™
Mouse Monoclonal Antibody
Marke: Novus Biologicals H00346606-M05
Dieser Artikel kann nicht zurückgegeben werden.
Rückgaberichtlinie anzeigen
Beschreibung
MOGAT3 Monoclonal antibody specifically detects MOGAT3 in Human samples. It is validated for Western Blot, ELISA, Immunocytochemistry/ Immunofluorescence
Spezifikation
| MOGAT3 | |
| Monoclonal | |
| Unconjugated | |
| In 1x PBS, pH 7.4 | |
| acyl coenzyme A:monoacylglycerol acyltransferase 3, Acyl-CoA:monoacylglycerol acyltransferase 3, DC72-acylglycerol O-acyltransferase 3, DGAT2L7MGC119203, Diacylglycerol acyltransferase 2-like protein 7, Diacylglycerol O-acyltransferase candidate 7, EC 2.3.1.20, EC 2.3.1.22, MGAT3, MGC119204, monoacylglycerol O-acyltransferase 3hDC7 | |
| MOGAT3 (NP_835470, 59 a.a. ∽ 107 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. YLVWLYVDWDTPNQGGRRSEWIRNRAIWRQLRDYYPVKLVKTAELPPDR | |
| 0.1 mg | |
| Primary | |
| Human | |
| Purified |
| Western Blot, ELISA, Immunocytochemistry/Immunofluorescence | |
| 3F7 | |
| Western Blot 1:500, ELISA, Immunocytochemistry/ Immunofluorescence | |
| NP_835470 | |
| Mouse | |
| IgG purified | |
| RUO | |
| 346606 | |
| Aliquot and store at -20°C or -80°C. Avoid freeze-thaw cycles. | |
| IgG1 κ |
Berichtigung von Produktinhalten
Bitte geben Sie uns Ihr Feedback zu den Produktinhalten, indem Sie das folgende Formular ausfüllen.
Name des Produkts
Haben Sie Verbesserungsvorschläge?Übermitteln Sie eine inhaltliche Korrektur