missing translation for 'onlineSavingsMsg'
Läs mer
  1. Home
  2. Products
  3. Antikörper
  4. Primärantikörper
  5. Alle Primärantikörper
  6. MUC21 Antibody, Novus Biologicals™

MUC21 Antibody, Novus Biologicals™

Produktkod. 18419471 Handla allt Bio Techne Produkter
Change view
Klicka för att se tillgängliga alternativ
Menge:
0.1 mL
25 μL
Förpackningsstorlek:
0.10 Milliliter
25 Mikroliter
Produktkod. Menge unitSize
18419471 25 μL 25 Mikroliter
18785843 0.1 mL 0.10 Milliliter
2 options
Denna artikel kan inte returneras. Se returpolicy

Produktkod. 18419471

Brand: Novus Biologicals NBP23102325ul

Bitte Sie sich an, um diesen Artikel zu kaufen. Sie benötigen ein Web-Konto? Registrieren Sie sich noch heute!

Denna artikel kan inte returneras. Se returpolicy

Beskrivning

Rabbit Polyclonal Antibody

MUC21 Polyclonal specifically detects MUC21 in Human samples. It is validated for Immunohistochemistry, Immunohistochemistry-Paraffin.
TRUSTED_SUSTAINABILITY

Specifikationer

Antigen MUC21
Anwendungen Immunohistochemistry, Immunohistochemistry (Paraffin)
Klassifikation Polyclonal
Konjugat Unconjugated
Verdünnung Immunohistochemistry, Immunohistochemistry-Paraffin 1:200 - 1:500
Zusammensetzung PBS (pH 7.2) and 40% Glycerol with 0.02% Sodium Azide
Gen-Zugriffsnummer Q5SSG8
Gen-Alias bCX31G15.2, C6orf205, Chromosome 6 Open Reading Frame 205, epiglycanin, KMQK697, MUC-21, Mucin 21, Cell Surface Associated, mucin-21
Gensymbole MUC21
Wirtsspezies Rabbit
Immunogen This antibody was developed against a recombinant protein corresponding to amino acids: CVRNSLSLRNTFNTAVYHPHGLNHGLGPGPGGNHGAPHRPRWSPNWFWRRPVSSIAMEMSGRNS
Reinigungsverfahren Affinity Purified
Menge 25 μL
Regulatorischer Status RUO
Primär oder sekundär Primary
Gen-ID (Entrez) 394263
Testspezifität Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Zielspezies Human
Inhalt und Lagerung Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Isotype IgG
Visa mer Visa mindre

For Research Use Only

Produkttitel
Välj ett problem

Genom att klicka på Skicka bekräftar du att du kan bli kontaktad av Fisher Scientific angående feedbacken du har lämnat i detta formulär. Vi kommer inte att dela din information för andra ändamål. All kontaktinformation som tillhandahålls ska också underhållas i enlighet med vår Sekretesspolicy.