missing translation for 'onlineSavingsMsg'
Learn More
  1. Home
  2. Products
  3. Antikörper
  4. Primärantikörper
  5. Alle Primärantikörper
  6. Muscle Phosphofructokinase/PFKM/PFK-1 Antibody, Novus Biologicals™

Muscle Phosphofructokinase/PFKM/PFK-1 Antibody, Novus Biologicals™

Código de producto. 18231266 Tienda Bio Techne Productos
Change view
Click to view available options
Menge:
0.1 mL
25 μL
Tamaño de la unidad:
0.10 Milliliter
25 Mikroliter
Código de producto. Menge unitSize
18231266 0.1 mL 0.10 Milliliter
18443971 25 μL 25 Mikroliter
2 options
Este artículo no se puede devolver. Vea la política de devoluciones

Código de producto. 18231266

Marca: Novus Biologicals NBP187293

Bitte Sie sich an, um diesen Artikel zu kaufen. Sie benötigen ein Web-Konto? Registrieren Sie sich noch heute!

Este artículo no se puede devolver. Vea la política de devoluciones

Descripción

Rabbit Polyclonal Antibody

Muscle Phosphofructokinase/PFKM/PFK-1 Polyclonal specifically detects Muscle Phosphofructokinase/PFKM/PFK-1 in Human, Rat samples. It is validated for Western Blot, Immunohistochemistry, Immunocytochemistry/Immunofluorescence, Immunohistochemistry-Paraffin.
TRUSTED_SUSTAINABILITY

Especificaciones

Antigen Muscle Phosphofructokinase/PFKM/PFK-1
Anwendungen Western Blot, Immunohistochemistry, Immunocytochemistry, Immunofluorescence, Immunohistochemistry (Paraffin)
Klassifikation Polyclonal
Konjugat Unconjugated
Verdünnung Western Blot 0.4 ug/ml, Immunohistochemistry 1:50 - 1:200, Immunocytochemistry/Immunofluorescence 1 - 4 ug/ml, Immunohistochemistry-Paraffin 1:50 - 1:200
Zusammensetzung PBS (pH 7.2) and 40% Glycerol with 0.02% Sodium Azide
Gen-Alias 6-phosphofructokinase, muscle type, EC 2.7.1,6-phosphofructo-1-kinase, EC 2.7.1.11, GSD7, MGC8699, PFK1, PFK-1, PFKA, PFK-A, PFKX, Phosphofructo-1-kinase isozyme A, Phosphofructokinase 1, phosphofructokinase, muscle, phosphofructokinase, polypeptide X, phosphofructokinase-M, phosphohexokinase
Gensymbole PFKM
Wirtsspezies Rabbit
Immunogen This antibody was developed against Recombinant Protein corresponding to amino acids:CVQVTKDVTKAMDEKKFDEALKLRGRSFMNNWEVYKLLAHVRPPVSKSGSHTVAVMNVGAPAAGMNAAVRSTVRIGLIQGNRVLVVHDGFEGLAKGQIEEAGWSYVGGWTGQGGSKLGTKRTLPKKSFEQISA
Reinigungsverfahren Affinity Purified
Menge 0.1 mL
Regulatorischer Status RUO
Forschungsgebiet Lipid and Metabolism
Primär oder sekundär Primary
Gen-ID (Entrez) 5213
Testspezifität Specificity of human Muscle Phosphofructokinase/PFKM/PFK-1 antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Zielspezies Human, Rat
Inhalt und Lagerung Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Isotype IgG
Mostrar más Mostrar menos

For Research Use Only

Título del producto
Seleccione un problema

Al hacer clic en Enviar, acepta que Fisher Scientific se ponga en contacto con usted en relación con los comentarios que ha proporcionado en este formulario. No compartiremos su información para ningún otro fin. Toda la información de contacto proporcionada se mantendrá de acuerdo con nuestra Política de Privacidad. Política de privacidad.