missing translation for 'onlineSavingsMsg'
Learn More
Learn More
Beschreibung
MxA/Mx1 Polyclonal specifically detects MxA/Mx1 in Human samples. It is validated for Western Blot, Immunocytochemistry/Immunofluorescence.
Spezifikation
Spezifikation
| Antigen | MxA/Mx1 |
| Anwendungen | Western Blot, Immunocytochemistry, Immunofluorescence |
| Klassifikation | Polyclonal |
| Konjugat | Unconjugated |
| Verdünnung | Western Blot 0.4 μg/mL, Immunocytochemistry/Immunofluorescence 1 - 4 μg/mL |
| Zusammensetzung | PBS, pH 7.2, containing 40% glycerol with 0.02% Sodium Azide |
| Gen-Alias | human interferon-regulated resistance GTP-binding protein MXA10IFI-78Khomolog of murine (interferon-inducibleprotein p78), myxovirus (influenza virus) resistance 1, interferon-inducible protein p78(mouse) |
| Gensymbole | MX1 |
| Wirtsspezies | Rabbit |
| Immunogen | This antibody was developed against a recombinant protein corresponding to the following amino acid sequence:MEEIFQHLMAYHQEASKRISSHIPLIIQFFMLQTYGQQLQKAMLQLLQDKDTYSWLLKERSDTSDKRKFLK |
| Mehr anzeigen |
For Research Use Only
Name des Produkts
Indem Sie auf Absenden klicken, erklären Sie sich damit einverstanden, dass Fisher Scientific sich mit Ihnen in Verbindung setzen kann, um Ihr Feedback in diesem Formular zu bearbeiten. Wir werden Ihre Informationen nicht für andere Zwecke weitergeben. Alle bereitgestellten Kontaktinformationen werden in Übereinstimmung mit unserer Datenschutzrichtlinie aufbewahrt. Datenschutzrichtlinie.
Haben Sie Verbesserungsvorschläge?