missing translation for 'onlineSavingsMsg'
Learn More
Learn More
Myosin light chain 3 Antibody, Novus Biologicals™
Rabbit Polyclonal Antibody
Marke: Novus Biologicals NBP2-57186
Dieser Artikel kann nicht zurückgegeben werden.
Rückgaberichtlinie anzeigen
Beschreibung
Myosin light chain 3 Polyclonal specifically detects Myosin light chain 3 in Human samples. It is validated for Western Blot, Immunohistochemistry, Immunohistochemistry-Paraffin.
Spezifikation
| Myosin light chain 3 | |
| Polyclonal | |
| Western Blot 0.4 ug/ml, Immunohistochemistry-Paraffin 1:1000 - 1:2500 | |
| Cardiac myosin light chain 1, CMH8Ventricular/slow twitch myosin alkali light chain, CMLC1, light polypeptide 3, alkali; ventricular, skeletal, slow, MLC1SBMyosin light chain 1, slow-twitch muscle B/ventricular isoform, MLC1V, myosin light chain 3, myosin, light chain 3, alkali; ventricular, skeletal, slow, VLC1 | |
| Rabbit | |
| Affinity Purified | |
| RUO | |
| 4634 | |
| Human | |
| IgG |
| Western Blot, Immunohistochemistry (Paraffin) | |
| Unconjugated | |
| PBS, pH 7.2, containing 40% glycerol with 0.02% Sodium Azide | |
| MYL3 | |
| This antibody was developed against a recombinant protein corresponding to the following amino acid sequence:AKNKDQGTYEDYVEGLRVFDKEGNGTVMGAEIR | |
| 100 μL | |
| Primary | |
| Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins. | |
| Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
Berichtigung von Produktinhalten
Bitte geben Sie uns Ihr Feedback zu den Produktinhalten, indem Sie das folgende Formular ausfüllen.
Name des Produkts
For Research Use Only
Haben Sie Verbesserungsvorschläge?Übermitteln Sie eine inhaltliche Korrektur