missing translation for 'onlineSavingsMsg'
Learn More
Learn More
Neuroplastin Antibody, Novus Biologicals™
Rabbit Polyclonal Antibody
280.00 € - 590.10 €
Spezifikation
| Antigen | Neuroplastin |
|---|---|
| Verdünnung | Western Blot 0.04-0.4 μg/mL, Immunohistochemistry 1:200 - 1:500, Immunohistochemistry-Paraffin 1:200 - 1:500 |
| Anwendungen | Western Blot, Immunohistochemistry, Immunohistochemistry (Paraffin) |
| Klassifikation | Polyclonal |
| Konjugat | Unconjugated |
| Produktcode | Marke | Menge | Preis | Menge & Verfügbarkeit | |||||
|---|---|---|---|---|---|---|---|---|---|
| Produktcode | Marke | Menge | Preis | Menge & Verfügbarkeit | |||||
|
18279491
|
Novus Biologicals
NBP2-56293 |
100 μL |
 624.00 € 590.10 € / 100 Mikroliter Sparen 33.90 € 5% Rabatt |
Bitte melden Sie sich an, um diesen Artikel zu kaufen. Sie benötigen ein Web-Konto? Registrieren Sie sich noch heute! | |||||
|
18673349
|
Novus Biologicals
NBP2-56293-25ul |
25 μL |
280.00 €
25 Mikroliter |
Bitte melden Sie sich an, um diesen Artikel zu kaufen. Sie benötigen ein Web-Konto? Registrieren Sie sich noch heute! | |||||
Beschreibung
Neuroplastin Polyclonal specifically detects Neuroplastin in Human samples. It is validated for Western Blot, Immunohistochemistry, Immunohistochemistry-Paraffin.Spezifikation
| Neuroplastin | |
| Western Blot, Immunohistochemistry, Immunohistochemistry (Paraffin) | |
| Unconjugated | |
| RUO | |
| GP55Stromal cell-derived receptor 1, GP65SDR-1, MGC102805, neuroplastin, np55, np65, SDFR1DKFZp686L2477, SDR1stromal cell derived factor receptor 1 | |
| NPTN | |
| IgG | |
| Affinity Purified |
| Western Blot 0.04-0.4 μg/mL, Immunohistochemistry 1:200 - 1:500, Immunohistochemistry-Paraffin 1:200 - 1:500 | |
| Polyclonal | |
| Rabbit | |
| PBS, pH 7.2, containing 40% glycerol with 0.02% Sodium Azide | |
| 27020 | |
| This antibody was developed against a recombinant protein corresponding to the following amino acid sequence:PRIVTSEEVIIRDSPVLPVTLQCNLTSSSHTLTYSYWTKNGVELSATRKNASNMEYRINKPRAEDSGEYHCVYHFV | |
| Primary | |
| Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins. |
For Research Use Only
Haben Sie Verbesserungsvorschläge?Übermitteln Sie eine inhaltliche Korrektur
Berichtigung von Produktinhalten
Bitte geben Sie uns Ihr Feedback zu den Produktinhalten, indem Sie das folgende Formular ausfüllen.
Name des Produkts