missing translation for 'onlineSavingsMsg'
Learn More
Learn More
NLRC5 Antibody, Novus Biologicals™
Rabbit Polyclonal Antibody
Marke: Novus Biologicals NBP2-56201-25ul
Dieser Artikel kann nicht zurückgegeben werden.
Rückgaberichtlinie anzeigen
Beschreibung
NLRC5 Polyclonal specifically detects NLRC5 in Human samples. It is validated for Immunocytochemistry/Immunofluorescence.
Spezifikation
| NLRC5 | |
| Polyclonal | |
| Immunocytochemistry/Immunofluorescence 1 - 4 μg/mL | |
| Caterpiller Protein 16.1, CLR16.1, NLR Family CARD Domain Containing 5, NOD27, NOD4, NOD-Like Receptor C5, Nucleotide-Binding Oligomerization Domain Protein 27, Nucleotide-Binding Oligomerization Domain Protein 4, Nucleotide-Binding Oligomerization Domains 27, Protein NLRC5 | |
| Rabbit | |
| Affinity Purified | |
| RUO | |
| 84166 | |
| Human | |
| IgG |
| Immunocytochemistry, Immunofluorescence | |
| Unconjugated | |
| PBS, pH 7.2, containing 40% glycerol with 0.02% Sodium Azide | |
| NLRC5 | |
| This antibody was developed against a recombinant protein corresponding to the following amino acid sequence:GLVRCFSTLQWLFRLDISFESQHILLRGDKTSRDMWATGSLPDFPAAAKFLGFRQRCIPRSLCLSECPLEPPSLTRLCATLKDCPGPLELQLSCEFLSDQ | |
| 25 μL | |
| Primary | |
| Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins. | |
| Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze/thaw cycles. |
Berichtigung von Produktinhalten
Bitte geben Sie uns Ihr Feedback zu den Produktinhalten, indem Sie das folgende Formular ausfüllen.
Name des Produkts
For Research Use Only
Haben Sie Verbesserungsvorschläge?Übermitteln Sie eine inhaltliche Korrektur