missing translation for 'onlineSavingsMsg'
Learn More
  1. Home
  2. Products
  3. Antikörper
  4. Primärantikörper
  5. Alle Primärantikörper
  6. NLRC5 Antibody, Novus Biologicals™

NLRC5 Antibody, Novus Biologicals™

Artikelnummer. p-200073762 Alle ansehen Bio Techne Produkte
Change view
Click to view available options
Menge:
25 μL
100 μL
Unit Size:
100 Mikroliter
25 Mikroliter
Product Code. Menge unitSize
18218981 100 μL 100 Mikroliter
18613528 25 μL 25 Mikroliter
2 options
This item is not returnable. View return policy

Product Code. 18218981

Brand: Novus Biologicals NBP256201

Bitte Sie sich an, um diesen Artikel zu kaufen. Sie benötigen ein Web-Konto? Registrieren Sie sich noch heute!

This item is not returnable. View return policy

Description

Rabbit Polyclonal Antibody

NLRC5 Polyclonal specifically detects NLRC5 in Human samples. It is validated for Immunocytochemistry/Immunofluorescence.
TRUSTED_SUSTAINABILITY

Specifications

Antigen NLRC5
Anwendungen Immunocytochemistry, Immunofluorescence
Klassifikation Polyclonal
Konjugat Unconjugated
Verdünnung Immunocytochemistry/Immunofluorescence 1-4 ug/ml
Zusammensetzung PBS, pH 7.2, containing 40% glycerol with 0.02% Sodium Azide
Gen-Alias Caterpiller Protein 16.1, CLR16.1, NLR Family CARD Domain Containing 5, NOD27, NOD4, NOD-Like Receptor C5, Nucleotide-Binding Oligomerization Domain Protein 27, Nucleotide-Binding Oligomerization Domain Protein 4, Nucleotide-Binding Oligomerization Domains 27, Protein NLRC5
Gensymbole NLRC5
Wirtsspezies Rabbit
Immunogen This antibody was developed against a recombinant protein corresponding to the following amino acid sequence:GLVRCFSTLQWLFRLDISFESQHILLRGDKTSRDMWATGSLPDFPAAAKFLGFRQRCIPRSLCLSECPLEPPSLTRLCATLKDCPGPLELQLSCEFLSDQ
Reinigungsverfahren Affinity Purified
Menge 100 μL
Regulatorischer Status RUO
Primär oder sekundär Primary
Gen-ID (Entrez) 84166
Testspezifität Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Zielspezies Human
Inhalt und Lagerung Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Isotype IgG
Show More Show Less

For Research Use Only

Product Title
Select an issue

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.