missing translation for 'onlineSavingsMsg'
Learn More
Learn More
OCTN1/SLC22A4 Antibody - BSA Free, Novus Biologicals™
Rabbit Polyclonal Antibody
Marke: Novus Biologicals NBP2-94155-0.02ml
Dieser Artikel kann nicht zurückgegeben werden.
Rückgaberichtlinie anzeigen
Beschreibung
OCTN1/SLC22A4 Polyclonal antibody specifically detects OCTN1/SLC22A4 in Human, Mouse, Rat samples. It is validated for Western Blot
Spezifikation
| OCTN1/SLC22A4 | |
| Polyclonal | |
| Western Blot 1:1000-1:2000 | |
| Ergothioneine transporter, ET transporter, ETT, MGC34546, MGC40524, OCTN1integral membrane transport protein, Organic cation/carnitine transporter 1, solute carrier family 22 (organic cation/ergothioneine transporter), member 4, solute carrier family 22 member 4, UT2H | |
| Recombinant fusion protein containing a sequence corresponding to amino acids 42-141 of human SLC22A4 (NP_003050.2). LAGTPEHRCRVPDAANLSSAWRNNSVPLRLRDGREVPHSCSRYRLATIANFSALGLEPGRDVDLGQLEQESCLDGWEFSQDVYLSTVVTEWNLVCEDNWK | |
| 0.02 mL | |
| Primary | |
| Human, Mouse, Rat | |
| Purified |
| Western Blot | |
| Unconjugated | |
| PBS (pH 7.3), 50% glycerol | |
| Rabbit | |
| Affinity purified | |
| RUO | |
| 6583 | |
| Store at -20°C. Avoid freeze-thaw cycles. | |
| IgG |
Berichtigung von Produktinhalten
Bitte geben Sie uns Ihr Feedback zu den Produktinhalten, indem Sie das folgende Formular ausfüllen.
Name des Produkts
Haben Sie Verbesserungsvorschläge?Übermitteln Sie eine inhaltliche Korrektur