missing translation for 'onlineSavingsMsg'
Learn More

ODZ3 Antibody, Novus Biologicals™

Artikelnummer. 18404722 Alle ansehen Bio Techne Produkte
Change view
Click to view available options
Menge:
0.1 mL
25ul
Packungsgröße:
0.10 Milliliter
25 Mikroliter
2 product options available for selection
Product selection table with 2 available options. Use arrow keys to navigate and Enter or Space to select.
Artikelnummer. Menge unitSize
18404722 25ul 25 Mikroliter
18080189 0.1 mL 0.10 Milliliter
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 2 options available.
2 options
Dieser Artikel kann nicht zurückgegeben werden. Rückgaberichtlinie anzeigen
Artikelnummer. 18404722 Lieferant Novus Biologicals Lieferanten-Nr. NBP21368725ul

Please to purchase this item. Need a web account? Register with us today!

Dieser Artikel kann nicht zurückgegeben werden. Rückgaberichtlinie anzeigen

Rabbit Polyclonal Antibody

ODZ3 Polyclonal specifically detects ODZ3 in Human samples. It is validated for Western Blot, Immunohistochemistry, Immunocytochemistry/Immunofluorescence, Immunohistochemistry-Paraffin.
TRUSTED_SUSTAINABILITY

Spezifikation

Antigen ODZ3
Anwendungen Western Blot, Immunohistochemistry, Immunocytochemistry, Immunofluorescence, Immunohistochemistry (Paraffin)
Klassifikation Polyclonal
Konjugat Unconjugated
Verdünnung Western Blot 0.4 ug/ml, Immunohistochemistry 1:50 - 1:200, Immunocytochemistry/Immunofluorescence 1 - 4 ug/ml, Immunohistochemistry-Paraffin 1:50 - 1:200
Zusammensetzung PBS (pH 7.2) and 40% Glycerol with 0.02% Sodium Azide
Gen-Alias FLJ10474, FLJ10886, KIAA1455odd Oz/Ten-m homolog 3, odz, odd Oz/ten-m homolog 3 (Drosophila), ODZ3-like protein, Protein Odd Oz/ten-m homolog 3, ten-3, tenascin-M3, teneurin-3, Ten-m3, TNM3
Gensymbole TENM3
Wirtsspezies Rabbit
Immunogen This antibody was developed against a recombinant protein corresponding to the amino acids: EPSYELVKSQQWDDIPPIFGVQQQVARQAKAFLSLGKMAEVQVSRRRAGGAQSWLWFATVKSLIGKGVMLAVSQGRVQTNVLN
Reinigungsverfahren Affinity Purified
Menge 25ul
Regulatorischer Status RUO
Forschungsgebiet Vision
Primär oder sekundär Primary
Gen-ID (Entrez) 55714
Testspezifität Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Zielspezies Human
Inhalt und Lagerung Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Isotype IgG
Mehr anzeigen Weniger anzeigen

For Research Use Only

Name des Produkts
Wählen Sie ein Thema

Indem Sie auf Absenden klicken, erklären Sie sich damit einverstanden, dass Fisher Scientific sich mit Ihnen in Verbindung setzen kann, um Ihr Feedback in diesem Formular zu bearbeiten. Wir werden Ihre Informationen nicht für andere Zwecke weitergeben. Alle bereitgestellten Kontaktinformationen werden in Übereinstimmung mit unserer Datenschutzrichtlinie aufbewahrt. Datenschutzrichtlinie.